1LT4: Heat-labile enterotoxin mutant S63K

Name: PDB 1LT4: Heat-labile enterotoxin mutant S63K
Published: 1997-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: enterotoxin

Heat-labile enterotoxin mutant S63K. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Jun 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 6
Atoms: 6,452
Mol. weight: 89.4 kDa
Released: 16 Jun 1997

Explore 1LT4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LT4 contains 40 α-helices and 41 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	2
α-helix	13-19	7
β-strand	21-22	2	3
α-helix	23-24	2
α-helix	36-38	3
α-helix	41-46	6
β-strand	59-62	4	4
β-strand	63	1	2
α-helix	66-76	11
β-strand	82-88	7	2
β-strand	94-96	3	4
α-helix	97-101	5
α-helix	102-104	3
α-helix	108-110	3
β-strand	113-116	4	4
β-strand	119-120	2	3
α-helix	121-123	3
β-strand	124-131	8	2
β-strand	134-135	2	2
α-helix	139	1
β-strand	140-141	2	2
α-helix	142	1
α-helix	147-151	5
α-helix	155-157	3
α-helix	158-160	3
α-helix	162-164	3
α-helix	172-175	4
α-helix	180-182	3
α-helix	198-222	25
α-helix	224-226	3
α-helix	232-235	4

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-77	19
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-78	18
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chains F and G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat-labile enterotoxin	D, E, F, G, H	protein	103	Escherichia coli	P32890 (AlphaFold model)
Heat-labile enterotoxin	A	protein	247	Escherichia coli	P06717 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H), FASTA

>1LT4_1 HEAT-LABILE ENTEROTOXIN (chains D, E, F, G, H)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Sequence of entity 2 (A), FASTA

>1LT4_2 HEAT-LABILE ENTEROTOXIN (chains A)
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYV
STKLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIP
YSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWI
HHAPQGCGNSSNSSRTITRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIY
NRIRDEL

Primary citation

Crystal structure of a non-toxic mutant of heat-labile enterotoxin, which is a potent mucosal adjuvant. van den Akker, F., Pizza, M., Rappuoli, R. et al. Protein Sci (1997) 6:2650-2654. PubMed

Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
6IAL 1.45 Å, Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose
1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
1LT5 1.7 Å, Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
1LT3 2.0 Å, Heat-labile enterotoxin double mutant N40C/G166C
1LTI 2.13 Å, Heat-labile enterotoxin (lt-I) complex with T-antigen

Browse structure collections

About this viewer

MolViewer shows 1LT4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.