1LT3: Heat-labile enterotoxin double mutant N40C/G166C

Name: PDB 1LT3: Heat-labile enterotoxin double mutant N40C/G166C
Published: 1997-07-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: enterotoxin

Heat-labile enterotoxin double mutant N40C/G166C. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Jul 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 6
Atoms: 6,093
Mol. weight: 88.64 kDa
Released: 7 Jul 1997

Explore 1LT3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LT3 contains 38 α-helices and 42 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	2
α-helix	13-19	7
β-strand	21-22	2	3
α-helix	23-24	2
α-helix	41-46	6
β-strand	49	1	4
β-strand	52	1	4
β-strand	59-63	5	2
α-helix	66-76	11
β-strand	82-88	7	2
β-strand	94-96	3	2
α-helix	97-101	5
α-helix	102-104	3
β-strand	112-116	5	2
β-strand	119-120	2	3
α-helix	121-123	3
β-strand	124-131	8	2
β-strand	134-141	8	2
α-helix	142	1
α-helix	147-150	4
α-helix	155	1
β-strand	156	1	2
α-helix	157	1
α-helix	158-160	3
α-helix	162-164	3
α-helix	172-175	4
α-helix	179-182	4
α-helix	197-222	26
α-helix	223-226	4
α-helix	232-235	4

Chains D and E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	60-78	19
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-77	19
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat-labile enterotoxin	D, E, F, G, H	protein	103	Escherichia coli	P32890 (AlphaFold model)
Heat-labile enterotoxin	A	protein	240	Escherichia coli	P06717 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H), FASTA

>1LT3_1 HEAT-LABILE ENTEROTOXIN (chains D, E, F, G, H)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Sequence of entity 2 (A), FASTA

>1LT3_2 HEAT-LABILE ENTEROTOXIN (chains A)
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNICLYDHARGTQTGFVRYDDGYV
STSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIP
YSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLACFPPDHQAWREEPWI
HHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL

Primary citation

Crystal structure of heat-labile enterotoxin from Escherichia coli with increased thermostability introduced by an engineered disulfide bond in the A subunit. van den Akker, F., Feil, I.K., Roach, C. et al. Protein Sci (1997) 6:2644-2649. PubMed

Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
6IAL 1.45 Å, Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose
1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
1LT5 1.7 Å, Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
1LT4 2.0 Å, Heat-labile enterotoxin mutant S63K
1LTI 2.13 Å, Heat-labile enterotoxin (lt-I) complex with T-antigen

Browse structure collections

About this viewer

MolViewer shows 1LT3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.