6IAL: Heat-labile enterotoxin B chain
Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose. Determined by X-ray diffraction at 1.45 Å resolution. Released 27 Feb 2019.
- Method
- X-ray diffraction
- Resolution
- 1.45 Å
- Organism
- Escherichia coli
- Chains
- 10
- Atoms
- 9,440
- Mol. weight
- 120.77 kDa
- Ligands
- CA
- Released
- 27 Feb 2019
Explore 6IAL in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6IAL contains 33 α-helices and 62 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 26-30 | 5 | 3 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 47-50 | 4 | 3 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 95-102 | 8 | 3 |
Chains B and E: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 26-30 | 5 | 3 |
| β-strand | 37-41 | 5 | 3 |
| β-strand | 47-51 | 5 | 3 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 94-102 | 9 | 3 |
Chains C and F: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 26-30 | 5 | 3 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 47-50 | 4 | 3 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 94-102 | 9 | 3 |
Chain D: 3 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 32 | 1 | 2 |
| β-strand | 35 | 1 | 2 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 95-102 | 8 | 1 |
Chain G: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-49 | 3 | 1 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain H: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| α-helix | 94 | 1 | |
| β-strand | 95-102 | 8 | 1 |
Chain I: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 26-30 | 5 | 3 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 47-49 | 3 | 3 |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 94-102 | 9 | 3 |
Chain J: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 3 |
| β-strand | 26-32 | 7 | 3 |
| β-strand | 35-42 | 8 | 3 |
| β-strand | 46-50 | 5 | 3 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 95-102 | 8 | 3 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Heat-labile enterotoxin B chain | A, B, C, D, E, F, G, H, I, J | protein | 103 | Escherichia coli | P32890 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>6IAL_1 Heat-labile enterotoxin B chain (chains A, B, C, D, E, F, G, H, I, J)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (NA, GOL) are not listed.
Primary citation
Specificity ofEscherichia coliHeat-Labile Enterotoxin Investigated by Single-Site Mutagenesis and Crystallography. Heggelund, J.E., Heim, J.B., Bajc, G. et al. Int J Mol Sci (2019) 20. DOI 10.3390/ijms20030703 · PubMed
Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
- 1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
- 5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
- 1LT5 1.7 Å, Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
- 1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
- 1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
- 2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
- 1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
- 1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
- 1LT3 2.0 Å, Heat-labile enterotoxin double mutant N40C/G166C
- 1LT4 2.0 Å, Heat-labile enterotoxin mutant S63K
- 1LTI 2.13 Å, Heat-labile enterotoxin (lt-I) complex with T-antigen
Browse structure collections
About this viewer
MolViewer shows 6IAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.