1LT5: Heat-labile enterotoxin B-pentamer

Name: PDB 1LT5: Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
Published: 1997-12-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: enterotoxin

Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Dec 1997.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Escherichia coli
Chains: 5
Atoms: 4,650
Mol. weight: 60.83 kDa
Released: 3 Dec 1997

Explore 1LT5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LT5 contains 20 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-32	7	1
β-strand	35-41	7	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-77	17
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-77	19
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-78	18
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-78	18
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-32	7	1
β-strand	35-41	7	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-77	19
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat-labile enterotoxin	D, E, F, G, H	protein	103	Escherichia coli	P32890 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H), FASTA

>1LT5_1 HEAT-LABILE ENTEROTOXIN (chains D, E, F, G, H)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Primary citation

Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin. Merritt, E.A., Sarfaty, S., Feil, I.K. et al. Structure (1997) 5:1485-1499. DOI 10.1016/S0969-2126(97)00298-0 · PubMed

Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
6IAL 1.45 Å, Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose
1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
1LT3 2.0 Å, Heat-labile enterotoxin double mutant N40C/G166C
1LT4 2.0 Å, Heat-labile enterotoxin mutant S63K
1LTI 2.13 Å, Heat-labile enterotoxin (lt-I) complex with T-antigen

Browse structure collections

About this viewer

MolViewer shows 1LT5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.