1JRJ: Exendin-4 in 30-vol% trifluoroethanol

Solution structure of exendin-4 in 30-vol% trifluoroethanol. Determined by solution NMR. Released 21 Nov 2001.

Method: Solution NMR
Chains: 1
Atoms: 295
Mol. weight: 4.19 kDa
Released: 21 Nov 2001

Explore 1JRJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JRJ contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-27	21
α-helix	30-32	3
α-helix	36-37	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Exendin-4	A	protein	39		P26349 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JRJ_1 Exendin-4 (chains A)
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Primary citation

Exendin-4 and glucagon-like-peptide-1: NMR structural comparisons in the solution and micelle-associated states. Neidigh, J.W., Fesinmeyer, R.M., Prickett, K.S. et al. Biochemistry (2001) 40:13188-13200. DOI 10.1021/bi010902s · PubMed

Other PDB entries of the same protein (UniProt P26349 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OTT 1.92 Å, Extracellular domain of GLP-1 receptor in complex with exendin-4 variant Gly2Hcs/Thr5Hcs
3C5T 2.1 Å, Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular…
3C59 2.3 Å, Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular…
7LLL 3.7 Å, Exendin-4-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in complex with Gs protein
2MJ9 Designed Exendin-4 analogues
2NAV NMR solution structure of Ex-4[1-16]/pl14a
2NAW NMR solution structure of Exendin-4/conotoxin chimera (Ex-4[1-27]/pl14a)
5NIQ exendin-4 variant with dual GLP-1 / glucagon receptor activity
6GDZ exendin-4 based dual GLP-1/glucagon receptor agonist
6GE2 exendin-4 based dual GLP-1/glucagon receptor agonist
7MLL Solution structure of Exenatide (exendin-4) in 30-vol% trifluoroethanol using CS-Rosetta
9G0M Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K

Browse structure collections

About this viewer

MolViewer shows 1JRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.