Solution structure of Exenatide (exendin-4) in 30-vol% trifluoroethanol using CS-Rosetta. Determined by solution NMR. Released 19 May 2021.
Explore 7MLL in 3D Show helices and sheets RCSB PDB PDBe
7MLL contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-27 | 18 | |
| α-helix | 30-32 | 3 | |
| α-helix | 35-38 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Exendin-4 | A | protein | 40 | Heloderma suspectum | P26349 (AlphaFold model) |
>7MLL_1 Exendin-4 (chains A) HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX
Facilitated structure verification of the biopharmaceutical peptide exenatide by 2D heteronuclear NMR maps. Mishra, S.H., Bhavaraju, S., Schmidt, D.R. et al. J Pharm Biomed Anal (2021) 203:114136-114136. DOI 10.1016/j.jpba.2021.114136 · PubMed
Other PDB entries of the same protein (UniProt P26349 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.