NMR solution structure of Exendin-4/conotoxin chimera (Ex-4[1-27]/pl14a). Determined by solution NMR. Released 18 May 2016.
Explore 2NAW in 3D Show helices and sheets RCSB PDB PDBe
2NAW contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| β-strand | 15 | 1 | 1 |
| α-helix | 22-27 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Exendin-4, Alpha/kappa-conotoxin pl14a chimera | A | protein | 39 | P26349 (AlphaFold model), Q0N4U8 (AlphaFold model) |
>2NAW_1 Exendin-4, Alpha/kappa-conotoxin pl14a chimera (chains A) HGEGTFTSDLSKQMEEEAVRCFIECLKGIGHKYPFCHCR
Truncated Glucagon-like Peptide-1 and Exendin-4 alpha-Conotoxin pl14a Peptide Chimeras Maintain Potency and alpha-Helicity and Reveal Interactions Vital for cAMP Signaling in Vitro. Swedberg, J.E., Schroeder, C.I., Mitchell, J.M. et al. J Biol Chem (2016) 291:15778-15787. DOI 10.1074/jbc.M116.724542 · PubMed
Other PDB entries of the same protein (UniProt P26349 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.