exendin-4 based dual GLP-1/glucagon receptor agonist. Determined by solution NMR. Released 20 Jun 2018.
Explore 6GDZ in 3D Show helices and sheets RCSB PDB PDBe
6GDZ contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-28 | 27 | |
| α-helix | 30-33 | 4 | |
| α-helix | 36-37 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Exendin-4 | A | protein | 40 | Heloderma suspectum | P26349 (AlphaFold model) |
>6GDZ_1 Exendin-4 (chains A) HAQGTFTSDLSKQKDEQRAKLFIEWLAAGGPSSGAPPPSX
| ID | Name | Formula | Copies |
|---|---|---|---|
| EVT | (2~{S})-2-[[(4~{S})-4-(hexadecanoylamino)-5-oxidanyl-5-oxidanylidene-pentanoyl]… | C26 H46 N2 O8 | 1 |
Dual Glucagon-like Peptide 1 (GLP-1)/Glucagon Receptor Agonists Specifically Optimized for Multidose Formulations. Evers, A., Bossart, M., Pfeiffer-Marek, S. et al. J Med Chem (2018) 61:5580-5593. DOI 10.1021/acs.jmedchem.8b00292 · PubMed
Other PDB entries of the same protein (UniProt P26349 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.