1JWF: Human GGA1 VHS domain

Crystal Structure of human GGA1 VHS domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 6 Mar 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,151
Mol. weight: 16.81 kDa
Released: 6 Mar 2002

Explore 1JWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JWF contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-38	12
α-helix	43-55	13
α-helix	60-76	17
α-helix	78-85	8
α-helix	88-98	11
α-helix	109-125	17
α-helix	130-141	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A	protein	147	Homo sapiens	Q9UJY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JWF_1 ADP-ribosylation factor binding protein GGA1 (chains A)
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKS

Primary citation

Structural basis for recognition of acidic-cluster dileucine sequence by GGA1. Shiba, T., Takatsu, H., Nogi, T. et al. Nature (2002) 415:937-941. DOI 10.1038/415937a · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1
3G2W 2.4 Å, VHS Domain of human GGA1 complexed with a DXXLL hinge peptide

Browse structure collections

About this viewer

MolViewer shows 1JWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.