1O3X: Human GGA1 GAT domain

Name: PDB 1O3X: Crystal structure of human GGA1 GAT domain
Published: 2003-05-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein transport

Crystal structure of human GGA1 GAT domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 May 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 994
Mol. weight: 16 kDa
Released: 20 May 2003

Explore 1O3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O3X contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	198-234	37
α-helix	243-267	25
α-helix	274-299	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A	protein	140	Homo sapiens	Q9UJY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1O3X_1 ADP-ribosylation factor binding protein GGA1 (chains A)
NVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNV
KLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQAND
NLTQVINLYKQLVRGEEVNG

Primary citation

Molecular Mechanism of Membrane Recruitment of Gga by Arf in Lysosomal Protein Transport. Shiba, T., Kawasaki, M., Takatsu, H. et al. Nat Struct Biol (2003) 10:386-393. DOI 10.1038/nsb920 · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1
3G2W 2.4 Å, VHS Domain of human GGA1 complexed with a DXXLL hinge peptide

Browse structure collections

About this viewer

MolViewer shows 1O3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.