1K1G: SF1-Bo isoform

Structural basis for recognition of the intron branch site RNA by splicing factor 1. Determined by solution NMR. Released 7 Nov 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,186
Mol. weight: 18.16 kDa
Released: 7 Nov 2001

Explore 1K1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K1G contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	136-141	6	1
α-helix	150-157	8
α-helix	162-170	9
β-strand	174-179	6	1
β-strand	203-209	7	1
α-helix	212-226	15
α-helix	238-244	7
α-helix	245-251	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-r(upapupapcpupapapcpap*a)-3'	B	RNA	11
SF1-Bo isoform	A	protein	131	Homo sapiens	Q15637 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1K1G_1 5'-R(*UP*AP*UP*AP*CP*UP*AP*AP*CP*AP*A)-3' (chains B)
UAUACUAACAA

Sequence of entity 2 (A), FASTA

>1K1G_2 SF1-Bo isoform (chains A)
GAMATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVG
RKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELAR
LNGTLREDDNR

Primary citation

Structural basis for recognition of the intron branch site RNA by splicing factor 1. Liu, Z., Luyten, I., Bottomley, M.J. et al. Science (2001) 294:1098-1102. DOI 10.1126/science.1064719 · PubMed

Other PDB entries of the same protein (UniProt Q15637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FXW 2.29 Å, Structure of phosphorylated SF1 complex with U2AF65-UHM domain
4FXX 2.48 Å, Structure of SF1 coiled-coil domain
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
1O0P Solution Structure of the third RNA Recognition Motif (RRM) of U2AF65 in complex with an…
1OPI Solution structure of the third RNA recognition motif (RRM) of U2AF65 in complex with an…
2M09 Structure, phosphorylation and U2AF65 binding of the Nterminal Domain of splicing factor…
2M0G Structure, phosphorylation and U2AF65 binding of the Nterminal Domain of splicing factor…
7VH9 Solution structure of the chimeric peptide of the first SURP domain of Human SF3A1 and…
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1

Browse structure collections

About this viewer

MolViewer shows 1K1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.