7VH9: Splicing factor 3A subunit 1,Splicing factor 1

Name: PDB 7VH9: Solution structure of the chimeric peptide of the first SURP domain of Human SF3A1 and the interacting region of SF1.
Published: 2022-09-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: splicing

Solution structure of the chimeric peptide of the first SURP domain of Human SF3A1 and the interacting region of SF1. Determined by solution NMR. Released 28 Sept 2022.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 854
Mol. weight: 12.13 kDa
Released: 28 Sept 2022

Explore 7VH9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VH9 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-17	15
α-helix	19-28	10
α-helix	36-38	3
α-helix	43-57	15
α-helix	81-84	4
α-helix	89-104	16
α-helix	106-108	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor 3A subunit 1,Splicing factor 1	A	protein	111	Homo sapiens	Q15459 (AlphaFold model), Q15637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VH9_1 Splicing factor 3A subunit 1,Splicing factor 1 (chains A)
GEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKA
QEPSSGSSGSSGSSGSSGQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPA

Primary citation

Structural basis for the interaction between the first SURP domain of the SF3A1 subunit in U2 snRNP and the human splicing factor SF1. Nameki, N., Takizawa, M., Suzuki, T. et al. Protein Sci (2022) 31:e4437-e4437. DOI 10.1002/pro.4437 · PubMed

Other PDB entries of the same protein (UniProt Q15459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P0V 1.56 Å, Crystal structure of human SF3A1 ubiquitin-like domain in complex with U1 snRNA…
8ID2 1.8 Å, Crystal structure of the ubiquitin-like domain in the SF3A1 subunit of human U2 snRNP…
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8I0T 3.0 Å, The cryo-EM structure of human Bact-III complex
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)

Browse structure collections

About this viewer

MolViewer shows 7VH9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.