The X-ray Structure of Human Angiostatin. Determined by X-ray diffraction at 1.75 Å resolution. Released 29 May 2002.
Explore 1KI0 in 3D Show helices and sheets RCSB PDB PDBe
1KI0 contains 13 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85 | 1 | 1 |
| β-strand | 98 | 1 | 2 |
| α-helix | 103 | 1 | |
| β-strand | 104 | 1 | 2 |
| β-strand | 105 | 1 | 3 |
| α-helix | 106-107 | 2 | |
| β-strand | 134 | 1 | 4 |
| β-strand | 144-146 | 3 | 4 |
| β-strand | 147 | 1 | 3 |
| β-strand | 154-156 | 3 | 4 |
| α-helix | 160 | 1 | |
| β-strand | 161 | 1 | 1 |
| α-helix | 162 | 1 | |
| β-strand | 163 | 1 | 5 |
| β-strand | 167 | 1 | 6 |
| β-strand | 174 | 1 | 5 |
| β-strand | 180 | 1 | 7 |
| α-helix | 185 | 1 | |
| β-strand | 186 | 1 | 7 |
| β-strand | 187 | 1 | 8 |
| α-helix | 188-189 | 2 | |
| β-strand | 216 | 1 | 9 |
| β-strand | 225-227 | 3 | 9 |
| β-strand | 228 | 1 | 8 |
| β-strand | 235-237 | 3 | 9 |
| α-helix | 240-241 | 2 | |
| β-strand | 242 | 1 | 6 |
| α-helix | 243 | 1 | |
| α-helix | 246-249 | 4 | |
| β-strand | 254 | 1 | 10 |
| β-strand | 257 | 1 | 11 |
| β-strand | 264 | 1 | 10 |
| β-strand | 270 | 1 | 12 |
| α-helix | 275 | 1 | |
| β-strand | 276 | 1 | 12 |
| β-strand | 277 | 1 | 13 |
| α-helix | 278-279 | 2 | |
| α-helix | 296-298 | 3 | |
| β-strand | 306 | 1 | 14 |
| β-strand | 315-317 | 3 | 14 |
| β-strand | 318 | 1 | 13 |
| β-strand | 325-327 | 3 | 14 |
| α-helix | 330-331 | 2 | |
| β-strand | 332 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiostatin | A | protein | 253 | Homo sapiens | P00747 (AlphaFold model) |
>1KI0_1 ANGIOSTATIN (chains A) LSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDP QGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGY IPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGT GENYRGNVAVTVSGHTCQHWSAQTPHTHERTPENFPCKNLDENYCRNPDGKRAPWCHTTN SQVRWEYCKIPSC
| ID | Name | Formula | Copies |
|---|---|---|---|
| BCN | Bicine | C6 H13 N O4 | 3 |
The X-ray crystallographic structure of the angiogenesis inhibitor angiostatin. Abad, M.C., Arni, R.K., Grella, D.K. et al. J Mol Biol (2002) 318:1009-1017. DOI 10.1016/S0022-2836(02)00211-5 · PubMed
Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.