Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen. Determined by X-ray diffraction at 1.66 Å resolution. Released 25 Mar 1998.
Explore 5HPG in 3D Show helices and sheets RCSB PDB PDBe
5HPG contains 8 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 15 | 1 | 2 |
| α-helix | 20 | 1 | |
| β-strand | 21 | 1 | 2 |
| β-strand | 22 | 1 | 3 |
| α-helix | 23-24 | 2 | |
| β-strand | 52 | 1 | 4 |
| β-strand | 62-64 | 3 | 4 |
| β-strand | 65 | 1 | 3 |
| β-strand | 72-74 | 3 | 4 |
| α-helix | 78 | 1 | |
| β-strand | 79 | 1 | 1 |
| α-helix | 80-82 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen | A, B | protein | 84 | Homo sapiens | P00747 (AlphaFold model) |
>5HPG_1 PLASMINOGEN (chains A, B) DCMFGNGKGYRGKRVTTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVG GPWCYTTNPRKLYDYCDVPQCAAP
Structure and ligand binding determinants of the recombinant kringle 5 domain of human plasminogen. Chang, Y., Mochalkin, I., McCance, S.G. et al. Biochemistry (1998) 37:3258-3271. DOI 10.1021/bi972284e · PubMed
Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HPG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.