Macrocyclic plasmin inhibitor. Determined by X-ray diffraction at 1.57 Å resolution. Released 15 Mar 2023.
Explore 7UAH in 3D Show helices and sheets RCSB PDB PDBe
7UAH contains 22 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 563 | 1 | 1 |
| β-strand | 566-567 | 2 | 2 |
| α-helix | 568-569 | 2 | |
| β-strand | 576-581 | 6 | 3 |
| β-strand | 586-594 | 9 | 3 |
| β-strand | 597-600 | 4 | 3 |
| α-helix | 602-605 | 4 | |
| α-helix | 611-613 | 3 | |
| β-strand | 614-618 | 5 | 3 |
| β-strand | 622 | 1 | 4 |
| β-strand | 631-640 | 10 | 3 |
| β-strand | 648-652 | 5 | 3 |
| α-helix | 655-658 | 4 | |
| α-helix | 664-665 | 2 | |
| β-strand | 666 | 1 | 2 |
| α-helix | 667-669 | 3 | |
| α-helix | 674-675 | 2 | |
| β-strand | 679-684 | 6 | 2 |
| β-strand | 696 | 1 | 4 |
| β-strand | 698-705 | 8 | 2 |
| α-helix | 707-710 | 4 | |
| β-strand | 724-727 | 4 | 2 |
| β-strand | 735 | 1 | 1 |
| β-strand | 744-749 | 6 | 2 |
| β-strand | 752-761 | 10 | 2 |
| β-strand | 772-776 | 5 | 2 |
| α-helix | 777-779 | 3 | |
| α-helix | 781-790 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 554-555 | 2 | |
| α-helix | 557-558 | 2 | |
| β-strand | 563 | 1 | 5 |
| β-strand | 566-567 | 2 | 6 |
| α-helix | 568-569 | 2 | |
| β-strand | 576-581 | 6 | 7 |
| β-strand | 586-594 | 9 | 7 |
| β-strand | 597-600 | 4 | 7 |
| α-helix | 602-605 | 4 | |
| α-helix | 611-613 | 3 | |
| β-strand | 614-618 | 5 | 7 |
| β-strand | 622 | 1 | 8 |
| β-strand | 631-640 | 10 | 7 |
| β-strand | 648-652 | 5 | 7 |
| α-helix | 655-658 | 4 | |
| β-strand | 659 | 1 | 9 |
| β-strand | 662 | 1 | 9 |
| α-helix | 664-665 | 2 | |
| β-strand | 666 | 1 | 6 |
| α-helix | 667-669 | 3 | |
| α-helix | 674-675 | 2 | |
| β-strand | 679-684 | 6 | 6 |
| β-strand | 696 | 1 | 8 |
| β-strand | 698-705 | 8 | 6 |
| α-helix | 707-710 | 4 | |
| β-strand | 724-727 | 4 | 6 |
| β-strand | 735 | 1 | 5 |
| β-strand | 744-749 | 6 | 6 |
| β-strand | 752-761 | 10 | 6 |
| β-strand | 772-776 | 5 | 6 |
| α-helix | 777-779 | 3 | |
| α-helix | 781-790 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen | A, B | protein | 250 | Homo sapiens | P00747 (AlphaFold model) |
>7UAH_1 Plasminogen (chains A, B) AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTA AHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDK VIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQ STELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFV TWIEGVMRNN
| ID | Name | Formula | Copies |
|---|---|---|---|
| NZ5 | (2~{R})-butane-1,2-diol | C4 H10 O2 | 1 |
| M63 | (6S,9R,19S,22R)-N-{[4-(aminomethyl)phenyl]methyl}-22-[(3-chlorobenzene-1-sulfon… | C42 H49 Cl N8 O6 S | 2 |
Water and common crystallization additives (SO4) are not listed.
Synthesis and Structural Characterization of Macrocyclic Plasmin Inhibitors. Wiedemeyer, S.J.A., Wu, G., Pham, T.L.P. et al. ChemMedChem (2023) 18:e202200632-e202200632. DOI 10.1002/cmdc.202200632 · PubMed
Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7UAH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.