1KRN: Plasminogen

Structure of kringle 4 at 4C temperature and 1.67 Å resolution. Determined by X-ray diffraction at 1.67 Å resolution. Released 11 Jan 1997.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Homo sapiens
Chains: 1
Atoms: 939
Mol. weight: 10 kDa
Released: 11 Jan 1997

Explore 1KRN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KRN contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	66-67	2	1
β-strand	80	1	2
β-strand	81	1	3
α-helix	85	1
β-strand	86	1	2
β-strand	87	1	4
α-helix	88-89	2
β-strand	116	1	5
β-strand	125-127	3	5
β-strand	128	1	4
β-strand	135-137	3	5
β-strand	138	1	3
β-strand	141-142	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A	protein	88	Homo sapiens	P00747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KRN_1 PLASMINOGEN (chains A)
VQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADK
GPWCFTTDPSVRWEYCNLKKCSGTEASV

Primary citation

Structure of human plasminogen kringle 4 at 1.68 a and 277 K. A possible structural role of disordered residues. Stec, B., Yamano, A., Whitlow, M. et al. Acta Crystallogr D Biol Crystallogr (1997) 53:169-178. DOI 10.1107/S0907444996012267 · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor
6D3X 1.8 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…

Browse structure collections

About this viewer

MolViewer shows 1KRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.