1KXL: Cell division control protein 13

Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded Telomeric DNA (DNA structure not modeled). Determined by solution NMR. Released 10 Apr 2002.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,559
Mol. weight: 23.58 kDa
Released: 10 Apr 2002

Explore 1KXL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KXL contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
β-strand	26-30	5	1
β-strand	36-38	3	2
β-strand	44-49	6	2
β-strand	80-85	6	2
α-helix	86-97	12
α-helix	104-107	4
β-strand	122-123	2	3
β-strand	124-129	6	1
β-strand	136-139	4	1
β-strand	143-144	2	3
α-helix	150-153	4
α-helix	155	1
α-helix	158-173	16
α-helix	175-180	6
α-helix	182-185	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division control protein 13	A	protein	199	Saccharomyces cerevisiae	P32797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KXL_1 CELL DIVISION CONTROL PROTEIN 13 (chains A)
MRMSKMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQN
YLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGI
VCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISR
YFEEYRRFFPIHRNGSHLA

Primary citation

Conserved structure for single-stranded telomeric DNA recognition. Mitton-Fry, R.M., Anderson, E.M., Hughes, T.R. et al. Science (2002) 296:145-147. DOI 10.1126/science.1068799 · PubMed

Other PDB entries of the same protein (UniProt P32797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HCE 2.3 Å, Crystal structure of the telomeric Saccharomyces cerevisiae Cdc13 OB2 domain
3OIQ 2.4 Å, Crystal structure of yeast telomere protein Cdc13 OB1 and the catalytic subunit of DNA…
3NWS 2.5 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
3OIP 2.5 Å, Crystal structure of Yeast telomere protein Cdc13 OB1
3NWT 2.7 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
1S40 Solution structure of the CDC13 DNA-binding domain complexed with a single-stranded…

Browse structure collections

About this viewer

MolViewer shows 1KXL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.