4HCE: Cell division control protein 13

Crystal structure of the telomeric Saccharomyces cerevisiae Cdc13 OB2 domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Nov 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,140
Mol. weight: 33.67 kDa
Released: 28 Nov 2012

Explore 4HCE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HCE contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	348-352	5
α-helix	354-355	2
β-strand	359-370	12	1
α-helix	377-380	4
β-strand	385-390	6	1
α-helix	391-393	3
β-strand	401	1	2
β-strand	403	1	3
β-strand	407	1	3
β-strand	408-412	5	1
α-helix	415-422	8
α-helix	424-426	3
α-helix	429-436	8
β-strand	444-453	10	1
β-strand	463-472	10	1

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	347-351	5
α-helix	354-355	2
β-strand	359-370	12	2
α-helix	377-380	4
β-strand	385-390	6	2
β-strand	401	1	1
β-strand	403	1	4
β-strand	407	1	4
β-strand	408-412	5	2
α-helix	415-422	8
α-helix	424-426	3
α-helix	429-435	7
β-strand	444-453	10	2
β-strand	463-472	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division control protein 13	A, B	protein	152	Saccharomyces cerevisiae	P32797 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4HCE_1 Cell division control protein 13 (chains A, B)
KAISYEQLSLASVGSVERLEGKIVGMNPPQFASINEFKYCTLKLYFTQLLPNVPDKVLVP
GVNCIEIVIPTRERICELFGVLNCQSDKISDILLLEKPDRISVEVERILWDNDKTASPGM
AVWSLKNISTDTQAQAQVQVPAQSSASIDPSR

Primary citation

Cdc13 OB2 Dimerization Required for Productive Stn1 Binding and Efficient Telomere Maintenance. Mason, M., Wanat, J.J., Harper, S. et al. Structure (2013) 21:109-120. DOI 10.1016/j.str.2012.10.012 · PubMed

Other PDB entries of the same protein (UniProt P32797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OIQ 2.4 Å, Crystal structure of yeast telomere protein Cdc13 OB1 and the catalytic subunit of DNA…
3NWS 2.5 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
3OIP 2.5 Å, Crystal structure of Yeast telomere protein Cdc13 OB1
3NWT 2.7 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
1KXL Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded…
1S40 Solution structure of the CDC13 DNA-binding domain complexed with a single-stranded…

Browse structure collections

About this viewer

MolViewer shows 4HCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.