1S40: CDC13 DNA-binding domain

Solution structure of the CDC13 DNA-binding domain complexed with a single-stranded telomeric DNA 11-mer. Determined by solution NMR. Released 4 May 2004.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,790
Mol. weight: 27.05 kDa
Released: 4 May 2004

Explore 1S40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S40 contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
β-strand	26-38	13	1
β-strand	46-50	5	1
β-strand	79-82	4	1
α-helix	86-100	15
α-helix	104-107	4
β-strand	121-128	8	1
β-strand	130-131	2	2
β-strand	134-135	2	2
β-strand	138-139	2	1
β-strand	143-144	2	1
α-helix	150-153	4
α-helix	158-172	15
α-helix	175-180	6
α-helix	182-185	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gptpgptpgpgpgptpgptp*g)-3'	B	DNA	11
Cell division control protein 13	A	protein	199	Saccharomyces cerevisiae	P32797 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1S40_1 5'-D(*GP*TP*GP*TP*GP*GP*GP*TP*GP*TP*G)-3' (chains B)
GTGTGGGTGTG

Sequence of entity 2 (A), FASTA

>1S40_2 Cell division control protein 13 (chains A)
MRMSKMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQN
YLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGI
VCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISR
YFEEYRRFFPIHRNGSHLA

Primary citation

Structural basis for telomeric single-stranded DNA recognition by yeast Cdc13. Mitton-Fry, R.M., Anderson, E.M., Theobald, D.L. et al. J Mol Biol (2004) 338:241-255. DOI 10.1016/j.jmb.2004.01.063 · PubMed

Other PDB entries of the same protein (UniProt P32797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HCE 2.3 Å, Crystal structure of the telomeric Saccharomyces cerevisiae Cdc13 OB2 domain
3OIQ 2.4 Å, Crystal structure of yeast telomere protein Cdc13 OB1 and the catalytic subunit of DNA…
3NWS 2.5 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
3OIP 2.5 Å, Crystal structure of Yeast telomere protein Cdc13 OB1
3NWT 2.7 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
1KXL Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded…

Browse structure collections

About this viewer

MolViewer shows 1S40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.