3OIQ: Cell division control protein 13

Crystal structure of yeast telomere protein Cdc13 OB1 and the catalytic subunit of DNA polymerase alpha Pol1. Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,773
Mol. weight: 30.71 kDa
Released: 3 Nov 2010

Explore 3OIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OIQ contains 9 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	15	1
β-strand	16-17	2	1
α-helix	21-25	5
β-strand	32-46	15	1
β-strand	50-56	7	1
β-strand	70-75	6	1
α-helix	79-95	17
β-strand	113-115	3	1
α-helix	118-120	3
β-strand	125-135	11	1
β-strand	138-148	11	1
α-helix	151-160	10
α-helix	178-195	18
α-helix	203-205	3
α-helix	211-221	11

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	217-239	23
β-strand	243	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division control protein 13	A	protein	233	Saccharomyces cerevisiae	P32797 (AlphaFold model)
DNA polymerase alpha catalytic subunit A	B	protein	36	Saccharomyces cerevisiae	P13382 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3OIQ_1 Cell division control protein 13 (chains A)
AHKNRIFVSSSKDFEGYPSKAIVPVQFVALLTSIHLTETKCLLGFSNFERRGDQSQEDQY
LIKLKFKDRGSERLARITISLLCQYFDIELPDLDSDSGASPTVILRDIHLERLCFSSCKA
LYVSKHGNYTLFLEDIKPLDLVSVISTISTKSTNSSKHSSSELISECDLNNSLVDIFNNL
IEMNRDEKNRFKFVKLIHYDIELKKFVQDQQKVLSQKSKAAAINPFFVPNRLG

Sequence of entity 2 (B), FASTA

>3OIQ_2 DNA polymerase alpha catalytic subunit A (chains B)
SPLKLQSRKLRYANDVQDLLDDVENSPVVATKRQNV

Primary citation

Structural bases of dimerization of yeast telomere protein Cdc13 and its interaction with the catalytic subunit of DNA polymerase alpha. Sun, J., Yang, Y., Wan, K. et al. Cell Res (2011) 21:258-274. DOI 10.1038/cr.2010.138 · PubMed

Other PDB entries of the same protein (UniProt P32797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HCE 2.3 Å, Crystal structure of the telomeric Saccharomyces cerevisiae Cdc13 OB2 domain
3NWS 2.5 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
3OIP 2.5 Å, Crystal structure of Yeast telomere protein Cdc13 OB1
3NWT 2.7 Å, Crystal structure of the N-terminal domain of the yeast telomere-binding and telomerase…
1KXL Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded…
1S40 Solution structure of the CDC13 DNA-binding domain complexed with a single-stranded…

Browse structure collections

About this viewer

MolViewer shows 3OIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.