1L9K: Dengue methyltransferase

Name: PDB 1L9K: dengue methyltransferase
Published: 2003-03-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

dengue methyltransferase. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Mar 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Dengue virus
Chains: 1
Atoms: 2,158
Mol. weight: 35.26 kDa
Ligands: SAH
Released: 25 Mar 2003

Explore 1L9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L9K contains 12 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	22-29	8
β-strand	34-37	4	1
α-helix	39-47	9
α-helix	58-66	9
β-strand	75-80	6	2
α-helix	86-91	6
β-strand	97-103	7	2
α-helix	121-123	3
β-strand	124-127	4	2
α-helix	132-134	3
β-strand	142-145	4	2
α-helix	154-169	16
β-strand	177-182	6	2
α-helix	188-200	13
β-strand	204-206	3	2
β-strand	218-221	4	2
α-helix	228-241	14
α-helix	249-250	2
β-strand	251-254	4	1
α-helix	255-256	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed RNA polymerase	A	protein	305	Dengue virus	P12823

Sequence of entity 1 (A), FASTA

>1L9K_1 RNA-DIRECTED RNA POLYMERASE (chains A)
MRGSHHHHHHGSNIGETLGEKWKSRLNALGKSEFQIYKKSGIQEVDRTLAKEGIKRGETD
HHAVSRGSAKLRWFVERNLVTPEGKVVDLGCGRGGWSYYCGGLKNVREVKGLTKGGPGHE
EPIPMSTYGWNLVRLQSGVDVFFIPPERCDTLLCDIGESSPNPTVEAGRTLRVLNLVENW
LSNNTQFCVKVLNPYMSSVIEKMEALQRKHGGALVRNPLSRNSTHEMYWVSNASGNIVSS
VNMISRMLINRFTMRHKKATYEPDVDLGSGTRNIGIESETPNLDIIGKRIEKIKQEHETS
WHYDQ

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

An RNA cap (nucleoside-2'-O-) methyltransferase in the flavivirus RNA polymerase NS5: crystal structure and functional characterization. Egloff, M.P., Benarroch, D., Selisko, B. et al. EMBO J (2002) 21:2757-2768. DOI 10.1093/emboj/21.11.2757 · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
5HHG 2.2 Å, Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex
1OKE 2.4 Å, Crystal structure of the dengue 2 virus envelope protein in complex with…
4M9I 2.4 Å, A125C NS2B-NS3 protease from dengue virus at pH 5.5
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5
2P40 2.7 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG

Browse structure collections

About this viewer

MolViewer shows 1L9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.