1LF7: Human Complement Protein C8gamma

Crystal Structure of Human Complement Protein C8gamma at 1.2 A Resolution. Determined by X-ray diffraction at 1.2 Å resolution. Released 12 Jun 2002.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,470
Mol. weight: 20.5 kDa
Ligands: CIT
Released: 12 Jun 2002

Explore 1LF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LF7 contains 9 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
α-helix	17-19	3
α-helix	24-27	4
β-strand	29-37	9	1
α-helix	50-52	3
β-strand	53-60	8	1
β-strand	63-72	10	1
β-strand	75-85	11	1
β-strand	91-94	4	1
β-strand	103-110	8	1
β-strand	115-122	8	1
β-strand	125-132	8	1
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	1
α-helix	162-163	2
α-helix	173-175	3
β-strand	176-178	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement Protein C8gamma	A	protein	182	Homo sapiens	P07360 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LF7_1 Complement Protein C8gamma (chains A)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAGRFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	1

Primary citation

Crystal structure of human complement protein C8gamma at 1.2 A resolution reveals a lipocalin fold and a distinct ligand binding site. Ortlund, E., Parker, C.L., Schreck, S.F. et al. Biochemistry (2002) 41:7030-7037. DOI 10.1021/bi025696i · PubMed

Other PDB entries of the same protein (UniProt P07360 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OVA 1.5 Å, X-ray structure of Human Complement Protein C8gamma Y83W Mutant
2OVD 1.8 Å, Crystal Structure of Human Complement Protein C8gamma with Laurate
2QOS 1.81 Å, Crystal structure of complement protein C8 in complex with a peptide containing the C8…
1IW2 1.9 Å, X-ray structure of Human Complement Protein C8gamma at pH=7.O
2OVE 2.0 Å, Crystal Structure of Recombinant Human Complement Protein C8gamma
2RD7 2.15 Å, Human Complement Membrane Attack Proteins Share a Common Fold with Bacterial Cytolysins
3OJY 2.51 Å, Crystal Structure of Human Complement Component C8
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC

Browse structure collections

About this viewer

MolViewer shows 1LF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.