2OVD: Human Complement Protein C8gamma with Laurate

Crystal Structure of Human Complement Protein C8gamma with Laurate. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 May 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,469
Mol. weight: 20.52 kDa
Ligands: DAO
Released: 22 May 2007

Explore 2OVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OVD contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
α-helix	17-19	3
α-helix	24-27	4
β-strand	29-37	9	1
β-strand	54-60	7	1
β-strand	63-72	10	1
β-strand	75-85	11	1
β-strand	91-94	4	1
β-strand	97	1	2
β-strand	100	1	2
α-helix	101-102	2
β-strand	103-110	8	1
β-strand	115-122	8	1
β-strand	125-132	8	1
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	1
α-helix	162-163	2
α-helix	173-175	3
β-strand	176-178	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component 8, gamma polypeptide	A	protein	182	Homo sapiens	P07360 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OVD_1 Complement component 8, gamma polypeptide (chains A)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAARFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Ligands and cofactors

ID	Name	Formula	Copies
DAO	Lauric acid	C12 H24 O2	1

Primary citation

Structural features of the ligand binding site on human complement protein C8gamma: A member of the lipocalin family. Chiswell, B., Lovelace, L.L., Brannen, C. et al. Biochim Biophys Acta (2007) 1774:637-644. DOI 10.1016/j.bbapap.2007.03.004 · PubMed

Other PDB entries of the same protein (UniProt P07360 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LF7 1.2 Å, Crystal Structure of Human Complement Protein C8gamma at 1.2 A Resolution
2OVA 1.5 Å, X-ray structure of Human Complement Protein C8gamma Y83W Mutant
2QOS 1.81 Å, Crystal structure of complement protein C8 in complex with a peptide containing the C8…
1IW2 1.9 Å, X-ray structure of Human Complement Protein C8gamma at pH=7.O
2OVE 2.0 Å, Crystal Structure of Recombinant Human Complement Protein C8gamma
2RD7 2.15 Å, Human Complement Membrane Attack Proteins Share a Common Fold with Bacterial Cytolysins
3OJY 2.51 Å, Crystal Structure of Human Complement Component C8
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC

Browse structure collections

About this viewer

MolViewer shows 2OVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.