2QOS: Complement protein C8

Crystal structure of complement protein C8 in complex with a peptide containing the C8 binding site on C8. Determined by X-ray diffraction at 1.81 Å resolution. Released 16 Oct 2007.

Method: X-ray diffraction
Resolution: 1.81 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,601
Mol. weight: 20.56 kDa
Released: 16 Oct 2007

Explore 2QOS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QOS contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	160-161	2	3
β-strand	166-167	2	3

Chain C: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
α-helix	17-19	3
α-helix	24-27	4
β-strand	29-37	9	1
α-helix	41-46	6
α-helix	47-49	3
β-strand	54-60	7	1
β-strand	63-72	10	1
β-strand	75-85	11	1
β-strand	91-94	4	1
β-strand	97	1	2
β-strand	100	1	2
β-strand	103-110	8	1
β-strand	115-122	8	1
β-strand	125-132	8	1
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	1
α-helix	162-163	2
α-helix	173-175	3
β-strand	176-178	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component 8, gamma polypeptide	C	protein	173	Homo sapiens	P07360 (AlphaFold model)
Complement component C8 alpha chain	A	protein	11		P07357 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2QOS_1 Complement component 8, gamma polypeptide (chains C)
ASPISTIQPKANFDAQQFAGTWLLVAVGSAARFLQEQGHRAEATTLHVAPQGTAMAVSTF
RKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVK
LYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Sequence of entity 2 (A), FASTA

>2QOS_2 Complement component C8 alpha chain (chains A)
LRYDSTAERLY

Primary citation

Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding. Lovelace, L.L., Chiswell, B., Slade, D.J. et al. Mol Immunol (2008) 45:750-756. DOI 10.1016/j.molimm.2007.06.359 · PubMed

Other PDB entries of the same protein (UniProt P07360 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LF7 1.2 Å, Crystal Structure of Human Complement Protein C8gamma at 1.2 A Resolution
2OVA 1.5 Å, X-ray structure of Human Complement Protein C8gamma Y83W Mutant
2OVD 1.8 Å, Crystal Structure of Human Complement Protein C8gamma with Laurate
1IW2 1.9 Å, X-ray structure of Human Complement Protein C8gamma at pH=7.O
2OVE 2.0 Å, Crystal Structure of Recombinant Human Complement Protein C8gamma
2RD7 2.15 Å, Human Complement Membrane Attack Proteins Share a Common Fold with Bacterial Cytolysins
3OJY 2.51 Å, Crystal Structure of Human Complement Component C8
8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC

Browse structure collections

About this viewer

MolViewer shows 2QOS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.