1LTI: Heat labile enterotoxin type I
Heat-labile enterotoxin (lt-I) complex with T-antigen. Determined by X-ray diffraction at 2.13 Å resolution. Released 17 Aug 1996.
- Method
- X-ray diffraction
- Resolution
- 2.13 Å
- Organism
- Escherichia coli
- Chains
- 7
- Atoms
- 6,220
- Mol. weight
- 87.83 kDa
- Ligands
- GAL
- Released
- 17 Aug 1996
Explore 1LTI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1LTI contains 38 α-helices and 43 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 15 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-9 | 5 | 2 |
| α-helix | 13-19 | 7 | |
| β-strand | 21-22 | 2 | 3 |
| α-helix | 23-24 | 2 | |
| α-helix | 41-45 | 5 | |
| β-strand | 59-62 | 4 | 4 |
| β-strand | 63 | 1 | 2 |
| α-helix | 66-76 | 11 | |
| α-helix | 77-79 | 3 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-96 | 3 | 4 |
| α-helix | 97-101 | 5 | |
| α-helix | 102-104 | 3 | |
| α-helix | 108-110 | 3 | |
| β-strand | 113-116 | 4 | 4 |
| β-strand | 119-120 | 2 | 3 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-131 | 8 | 2 |
| β-strand | 134-135 | 2 | 2 |
| β-strand | 140-141 | 2 | 2 |
| α-helix | 147-151 | 5 | |
| α-helix | 155-157 | 3 | |
| α-helix | 158-161 | 4 | |
| α-helix | 162-164 | 3 | |
| α-helix | 173-175 | 3 | |
| α-helix | 180-182 | 3 | |
| β-strand | 185 | 1 | 5 |
| β-strand | 187 | 1 | 5 |
Chain C: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 199-222 | 24 | |
| α-helix | 224-226 | 3 | |
| α-helix | 232-235 | 4 | |
Chains D, E and G: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain F: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-52 | 2 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain H: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-78 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Heat labile enterotoxin type I | D, E, F, G, H | protein | 103 | Escherichia coli | P32890 (AlphaFold model) |
| Heat labile enterotoxin type I | A | protein | 192 | Escherichia coli | P06717 (AlphaFold model) |
| Heat labile enterotoxin type I | C | protein | 48 | Escherichia coli | P06717 (AlphaFold model) |
Sequence of entity 1 (D, E, F, G, H), FASTA
>1LTI_1 HEAT LABILE ENTEROTOXIN TYPE I (chains D, E, F, G, H)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Sequence of entity 2 (A), FASTA
>1LTI_2 HEAT LABILE ENTEROTOXIN TYPE I (chains A)
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYV
STSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIP
YSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWI
HHAPQGCGNSSR
Sequence of entity 3 (C), FASTA
>1LTI_3 HEAT LABILE ENTEROTOXIN TYPE I (chains C)
TITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GAL | beta-D-galactopyranose | C6 H12 O6 | 3 |
Primary citation
Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli. van den Akker, F., Steensma, E., Hol, W.G. Protein Sci (1996) 5:1184-1188. PubMed
Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
- 6IAL 1.45 Å, Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose
- 1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
- 5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
- 1LT5 1.7 Å, Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
- 1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
- 1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
- 2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
- 1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
- 1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
- 1LT3 2.0 Å, Heat-labile enterotoxin double mutant N40C/G166C
- 1LT4 2.0 Å, Heat-labile enterotoxin mutant S63K
Browse structure collections
About this viewer
MolViewer shows 1LTI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.