1M2Z: Glucocorticoid receptor

Crystal structure of a dimer complex of the human glucocorticoid receptor ligand-binding domain bound to dexamethasone and a TIF2 coactivator motif. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,782
Mol. weight: 66.18 kDa
Ligands: BOG, DEX
Released: 15 Jul 2003

Explore 1M2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M2Z contains 25 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	541-545	5
β-strand	549	1	1
α-helix	556-578	23
α-helix	584-586	3
α-helix	589-616	28
β-strand	621-624	4	2
β-strand	627-629	3	2
α-helix	631-634	4
α-helix	639-655	17
α-helix	660-671	12
β-strand	674-676	3	3
α-helix	683-704	22
α-helix	711-740	30
α-helix	743-745	3
α-helix	751-760	10
α-helix	763-766	4
β-strand	769-771	3	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-748	6

Chain D: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	532-538	7
α-helix	541-543	3
β-strand	549	1	1
α-helix	556-580	25
α-helix	589-616	28
β-strand	621-624	4	4
β-strand	627-629	3	4
α-helix	631-634	4
α-helix	639-655	17
α-helix	660-671	12
β-strand	674-676	3	5
α-helix	683-702	20
α-helix	709-740	32
α-helix	751-766	16
β-strand	769-771	3	5

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-750	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
glucocorticoid receptor	A, D	protein	257	Homo sapiens	P04150 (AlphaFold model)
nuclear receptor coactivator 2	B, E	protein	21		Q15596 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1M2Z_1 glucocorticoid receptor (chains A, D)
VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKA
IPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMY
DQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQ
IPKYSNGNIKKLLFHQK

Sequence of entity 2 (B, E), FASTA

>1M2Z_2 nuclear receptor coactivator 2 (chains B, E)
PVSPKKKENALLRYLLDKDDT

Ligands and cofactors

ID	Name	Formula	Copies
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	3
DEX	Dexamethasone	C22 H29 F O5	2

Primary citation

Crystal Structure of the Glucocorticoid Receptor Ligand Binding Domain Reveals a Novel Mode of Receptor Dimerization and Coactivator Recognition. Bledsoe, R.B., Montana, V.G., Stanley, T.B. et al. Cell (2002) 110:93-105. DOI 10.1016/S0092-8674(02)00817-6 · PubMed

Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDD 1.8 Å, GR in complex with desisobutyrylciclesonide
5E69 1.85 Å, Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
4HN5 1.9 Å, GR DNA Binding Domain - TSLP nGRE Complex
4P6W 1.95 Å, Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
5CBY 2.0 Å, AncGR2 DNA Binding Domain - (+)GRE Complex
5CBX 2.0 Å, AncGR DNA Binding Domain - (+)GRE Complex
6X6E 2.0 Å, Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a…
5UC3 2.01 Å, Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P)…
6YMO 2.02 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide
6YO8 2.09 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide
3K22 2.1 Å, Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide

Browse more

1M2Z is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 1M2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.