1M4A: Interleukin-2

Crystal Structure of Human Interleukin-2 Y31C Covalently Modified at C31 with (1H-Indol-3-yl)-(2-mercapto-ethoxyimino)-acetic acid. Determined by X-ray diffraction at 2.18 Å resolution. Released 31 Jul 2002.

Method: X-ray diffraction
Resolution: 2.18 Å
Organism: Homo sapiens
Chains: 1
Atoms: 972
Mol. weight: 15.73 kDa
Ligands: MPE
Released: 31 Jul 2002

Explore 1M4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M4A contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-28	21
α-helix	33-39	7
β-strand	44	1	1
β-strand	47	1	2
α-helix	53-56	4
α-helix	57-61	5
α-helix	63-72	10
α-helix	84-95	12
β-strand	107	1	2
β-strand	112	1	1
α-helix	114-129	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
interleukin-2	A	protein	133	Homo sapiens	P60568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M4A_1 interleukin-2 (chains A)
APTSSSTKKTQLQLEHLLLDLQMILNGINNCKNPKLTRMLTFKFYMPKKATELKHLQCLE
EELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR
WITFCQSIISTLT

Ligands and cofactors

ID	Name	Formula	Copies
MPE	(1H-indol-3-yl)-(2-mercapto-ethoxyimino)-acetic acid	C12 H14 N2 O3 S	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Binding of small molecules to an adaptive protein-protein interface. Arkin, M.A., Randal, M., DeLano, W.L. et al. Proc Natl Acad Sci U S A (2003) 100:1603-1608. DOI 10.1073/pnas.252756299 · PubMed

Other PDB entries of the same protein (UniProt P60568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SOZ 1.64 Å, Structure of the complex formed by human interleukin-2 and scFv 602
8SOW 1.71 Å, Structure of the complex formed by human interleukin-2 and scFv F10
7M2G 1.79 Å, INTERLEUKIN-2 (human) mutant P65K, C125S
4NEJ 1.92 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
4NEM 1.93 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
1M48 1.95 Å, Crystal Structure of Human IL-2 Complexed with (R)-N-[2-[1-(Aminoiminomethyl)-3-piperidin…
5LQB 1.95 Å, Complex structure of human IL2 mutant, Proleukin, with Fab fragment of NARA1 antibody
1M47 1.99 Å, Crystal Structure of Human Interleukin-2
1M49 2.0 Å, Crystal Structure of Human Interleukin-2 Complexed with SP-1985
1M4B 2.15 Å, Crystal Structure of Human Interleukin-2 K43C Covalently Modified at C43 with…
1NBP 2.2 Å, Crystal Structure Of Human Interleukin-2 Y31C Covalently Modified At C31 With…
7RA9 2.2 Å, Designed StabIL-2 seq1

Browse structure collections

About this viewer

MolViewer shows 1M4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.