1M5N: HEAT repeats (1-11) of importin b

Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical NLS(67-94) of PTHrP. Determined by X-ray diffraction at 2.9 Å resolution. Released 21 Jan 2003.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,020
Mol. weight: 57.17 kDa
Released: 21 Jan 2003

Explore 1M5N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M5N contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	81-83	3

Chain S: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	5-9	5
α-helix	17-24	8
α-helix	27-30	4
α-helix	33-43	11
α-helix	51-63	13
α-helix	73-81	9
α-helix	88-94	7
α-helix	108-117	10
α-helix	129-137	9
α-helix	144-159	16
α-helix	163-166	4
α-helix	170-181	12
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-210	5
α-helix	212-224	13
α-helix	225-227	3
α-helix	231-247	17
α-helix	251-254	4
α-helix	256-260	5
α-helix	261-267	7
α-helix	273-299	27
α-helix	314-329	16
α-helix	344-358	15
α-helix	363-371	9
α-helix	372-374	3
α-helix	381-392	12
α-helix	399-401	3
α-helix	403-414	12
α-helix	422-437	16
α-helix	441-443	3
α-helix	446-460	15
α-helix	464-482	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin beta-1 subunit	S	protein	485	Homo sapiens	Q14974 (AlphaFold model)
Parathyroid hormone-related protein	Q	protein	28		P12272 (AlphaFold model)

Sequence of entity 1 (S), FASTA

>1M5N_1 Importin beta-1 subunit (chains S)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAA

Sequence of entity 2 (Q), FASTA

>1M5N_2 Parathyroid hormone-related protein (chains Q)
YLTQETNKVETYKEQPLKTPGKKKKGKP

Primary citation

Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta. Cingolani, G., Bednenko, J., Gillespie, M.T. et al. Mol Cell (2002) 10:1345-1353. DOI 10.1016/S1097-2765(02)00727-X · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 1M5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.