1M61: Apo SH2 domains of ZAP-70

Crystal structure of the apo SH2 domains of ZAP-70. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,099
Mol. weight: 29.37 kDa
Ligands: PO4
Released: 15 Jul 2003

Explore 1M61 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M61 contains 7 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
α-helix	17-25	9
β-strand	34-38	5	1
β-strand	42	1	2
β-strand	46-52	7	1
β-strand	55-61	7	1
β-strand	62-63	2	3
β-strand	69-70	2	3
β-strand	77	1	3
α-helix	80-89	10
β-strand	101	1	1
β-strand	111	1	1
α-helix	114-131	18
α-helix	135-153	19
α-helix	158-160	3
β-strand	164	1	4
α-helix	170-178	9
β-strand	187-191	5	4
β-strand	197-204	8	4
β-strand	207-215	9	4
β-strand	221-222	2	4
β-strand	228	1	2
β-strand	229	1	4
α-helix	232-239	8
β-strand	253	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase zap-70	A	protein	259	Homo sapiens	P43403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M61_1 TYROSINE-PROTEIN KINASE ZAP-70 (chains A)
GSHMPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFH
HFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDC
LRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKL
YSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVE
YLKLKADGLIYCLKEACPN

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Crystal structure and NMR studies of the apo SH2 domains of ZAP-70: two bikes rather than a tandem. Folmer, R.H.A., Geschwindner, S., Xue, Y. Biochemistry (2002) 41:14176-14184. DOI 10.1021/bi026465e · PubMed

Other PDB entries of the same protein (UniProt P43403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
2OQ1 1.9 Å, Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
4XZ0 2.0 Å, ZAP-70-tSH2:compound-A complex
2CBL 2.1 Å, N-terminal domain of cbl in complex with its binding site on zap-70
3ZNI 2.21 Å, Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
1U59 2.3 Å, Crystal Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine
5O76 2.47 Å, Structure of phosphoY371 c-CBL in complex with ZAP70-peptide and UbV.pCBL ubiquitin…
2OZO 2.6 Å, Autoinhibited intact human ZAP-70
4A4C 2.7 Å, Structure of phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4A4B 2.79 Å, Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4XZ1 2.8 Å, ZAP-70-tSH2:Compound-B adduct

Browse structure collections

About this viewer

MolViewer shows 1M61 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.