Mouse C-myb DNA-binding domain repeat 3. Determined by solution NMR. Released 31 Jul 1995.
Explore 1MBK in 3D Show helices and sheets RCSB PDB PDBe
1MBK contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 149-162 | 14 | |
| α-helix | 166-172 | 7 | |
| α-helix | 178-185 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myb proto-oncogene protein | A | protein | 53 | Mus musculus | P06876 (AlphaFold model) |
>1MBK_1 MYB PROTO-ONCOGENE PROTEIN (chains A) VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVX
Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb. Ogata, K., Morikawa, S., Nakamura, H. et al. Nat Struct Biol (1995) 2:309-320. DOI 10.1038/nsb0495-309 · PubMed
Other PDB entries of the same protein (UniProt P06876 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MBK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.