1MSE: C-Myb DNA-Binding Domain

Solution structure of a specific DNA complex of the myb DNA-binding domain with cooperative recognition helices. Determined by solution NMR. Released 31 Mar 1995.

Method: Solution NMR
Organism: Mus musculus
Chains: 3
Atoms: 1,341
Mol. weight: 22.47 kDa
Released: 31 Mar 1995

Explore 1MSE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MSE contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	97-109	13
α-helix	115-122	8
α-helix	127-133	7
α-helix	134-138	5
α-helix	149-161	13
α-helix	166-172	7
α-helix	179-188	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(cpcptpapapcptpgpapcpapcpapcpapt)-3')	A	DNA	16
DNA (5'-d(aptpgptpgptpgptpcpapgptptpapgpg)-3')	B	DNA	16
C-Myb DNA-Binding Domain	C	protein	105	Mus musculus	P06876 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MSE_1 DNA (5'-D(*CP*CP*TP*AP*AP*CP*TP*GP*AP*CP*AP*CP*AP*CP*AP*T)-3') (chains A)
CCTAACTGACACACAT

Sequence of entity 2 (B), FASTA

>1MSE_2 DNA (5'-D(*AP*TP*GP*TP*GP*TP*GP*TP*CP*AP*GP*TP*TP*AP*GP*G)-3') (chains B)
ATGTGTGTCAGTTAGG

Sequence of entity 3 (C), FASTA

>1MSE_3 C-Myb DNA-Binding Domain (chains C)
MLIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWT
EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV

Primary citation

Solution structure of a specific DNA complex of the Myb DNA-binding domain with cooperative recognition helices. Ogata, K., Morikawa, S., Nakamura, H. et al. Cell (1994) 79:639-648. DOI 10.1016/0092-8674(94)90549-5 · PubMed

Other PDB entries of the same protein (UniProt P06876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVD 1.45 Å, Crystal structure of C-myb R2 V103L mutant
1GV5 1.58 Å, Crystal structure of C-myb R2
1GUU 1.6 Å, Crystal structure of C-myb R1
1GV2 1.68 Å, Crystal structure of C-myb R2R3
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
1H89 2.45 Å, Crystal structure of ternary protein-DNA COMPLEX2
1H88 2.8 Å, Crystal structure of ternary protein-DNA COMPLEX1
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
1IDY Structure of myb transforming protein, NMR, minimized average structure
1IDZ Structure of myb transforming protein, NMR, 20 structures
1MBE Mouse C-myb DNA-binding domain repeat 1
1MBF Mouse C-myb DNA-binding domain repeat 1

Browse structure collections

About this viewer

MolViewer shows 1MSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.