1MVK: Immunoglobulin G binding protein G
X-ray structure of the tetrameric mutant of the B1 domain of streptococcal protein G. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Oct 2002.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Streptococcus sp. 'group G'
- Chains
- 12
- Atoms
- 4,718
- Mol. weight
- 75.92 kDa
- Released
- 30 Oct 2002
Explore 1MVK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1MVK contains 26 α-helices and 36 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C, F and G: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 1 |
| α-helix | 23-35 | 13 | |
| β-strand | 41-45 | 5 | 1 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-54 | 6 | 2 |
Chains B, H, J and L: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 41-45 | 5 | 1 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-54 | 6 | 2 |
Chain D: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 2 |
| α-helix | 23-36 | 14 | |
| β-strand | 41-45 | 5 | 2 |
| α-helix | 46-47 | 2 | |
| β-strand | 49-54 | 6 | 1 |
Chain E: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 3 |
| α-helix | 23-36 | 14 | |
| β-strand | 41-45 | 5 | 3 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-54 | 6 | 4 |
| α-helix | 55 | 1 | |
Chain I: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 5 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-45 | 4 | 5 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-54 | 6 | 6 |
| α-helix | 55 | 1 | |
Chain K: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-6 | 5 | 6 |
| α-helix | 23-36 | 14 | |
| β-strand | 41-45 | 5 | 6 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-53 | 5 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Immunoglobulin G binding protein G | A, B, C, D, E, F, G, H, I, J, K, L | protein | 56 | Streptococcus sp. 'group G' | P06654 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA
>1MVK_1 Immunoglobulin G binding protein G (chains A, B, C, D, E, F, G, H, I, J, K, L)
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Primary citation
Core mutations switch monomeric protein GB1 into an intertwined tetramer. Kirsten Frank, M., Dyda, F., Dobrodumov, A. et al. Nat Struct Biol (2002) 9:877-885. DOI 10.1038/nsb854 · PubMed
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
- 2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
- 3MP9 1.2 Å, Structure of Streptococcal protein G B1 domain at pH 3.0
- 6CNE 1.2 Å, Selenomethionine variant (V29SeM) of protein GB1
- 1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
- 6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
- 6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
- 6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
- 1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
- 4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
- 6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
- 1EM7 2.0 Å, Helix variant of the B1 domain from streptococcal protein G
Browse structure collections
About this viewer
MolViewer shows 1MVK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.