1NE6: PDB entry 1NE6

Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Jan 2004.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Bos taurus
Chains: 1
Atoms: 2,243
Mol. weight: 32.57 kDa
Ligands: SP1
Released: 13 Jan 2004

Explore 1NE6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NE6 contains 16 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	120-132	13
α-helix	134-136	3
α-helix	141-150	10
β-strand	152-156	5	1
β-strand	161-163	3	2
α-helix	168-169	2
β-strand	171-177	7	1
β-strand	180-184	5	2
β-strand	187-192	6	2
β-strand	197-198	2	1
α-helix	201-205	5
α-helix	207-209	3
β-strand	212-215	4	2
β-strand	219-225	7	1
α-helix	226-232	7
α-helix	234-249	16
α-helix	252-256	5
α-helix	259-268	10
β-strand	270-274	5	3
β-strand	279-281	3	4
β-strand	289-295	7	3
β-strand	298-303	6	4
β-strand	310-316	7	4
β-strand	321-322	2	3
α-helix	324-325	2
α-helix	326-330	5
β-strand	336-339	4	4
β-strand	343-349	7	3
α-helix	350-356	7
α-helix	358-360	3
α-helix	361-366	6
α-helix	367-370	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory chain	A	protein	283	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NE6_1 cAMP-dependent protein kinase type I-alpha regulatory chain (chains A)
RRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFP
VSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATV
KAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQ
FEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPR
AATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVS

Ligands and cofactors

ID	Name	Formula	Copies
SP1	6-(6-amino-purin-9-yl)-2-thioxo-tetrahydro-2-FURO[3,2-D][1,3,2]DIOXAPHOSPHININE…	C10 H12 N5 O5 P S	2

Primary citation

Crystal Structures of RIalpha Subunit of Cyclic Adenosine 5'-Monophosphate (cAMP)-Dependent Protein Kinase Complexed with (R(p))-Adenosine 3',5'-Cyclic Monophosphothioate and (S(p))-Adenosine 3',5'-Cyclic Monophosphothioate, the Phosphothioate Analogues of cAMP. Wu, J., Jones, J.M., Xuong, N.H. et al. Biochemistry (2004) 43:6620-6629. DOI 10.1021/bi0302503 · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase
1RGS 2.8 Å, Regulatory subunit of camp dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 1NE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.