1NPH: Gelsolin

Gelsolin Domains 4-6 in Active, Actin Free Conformation Identifies Sites of Regulatory Calcium Ions. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 May 2003.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,454
Mol. weight: 36.43 kDa
Ligands: CA
Released: 13 May 2003

Explore 1NPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NPH contains 12 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	420-426	7	1
β-strand	429-432	4	1
α-helix	435-437	3
β-strand	440-442	3	2
β-strand	446-452	7	1
β-strand	461-467	7	1
α-helix	473-489	17
β-strand	495-500	6	1
α-helix	506-510	5
β-strand	517-520	4	2
β-strand	537-543	7	2
β-strand	549-554	6	2
α-helix	558-560	3
β-strand	562	1	3
β-strand	566-570	5	2
β-strand	575-579	5	2
α-helix	585-598	14
β-strand	602-606	5	2
α-helix	612-618	7
β-strand	625	1	3
α-helix	628-631	4
α-helix	635-637	3
β-strand	641-646	6	4
β-strand	653-656	4	4
α-helix	657-658	2
α-helix	663-665	3
β-strand	671-675	5	4
β-strand	680-684	5	4
α-helix	690-704	15
β-strand	717-721	5	4
α-helix	727-730	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gelsolin	A	protein	329	Mus musculus	P13020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NPH_1 Gelsolin (chains A)
DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ
DEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAP
ASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTAAQE
LLKVLRSQHVQVEEGSEPDGFWEALGGKTSYRTSPRLKDKKMDAHPPRLFACSNRIGRFV
IEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDR
RTPITVVRQGFEPPSFVGWFLGWDNNYWS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Gelsolin Domains 4-6 in Active, Actin-Free Conformation Identifies Sites of Regulatory Calcium Ions. Kolappan, S., Gooch, J.T., Weeds, A.G. et al. J Mol Biol (2003) 329:85-92. DOI 10.1016/S0022-2836(03)00383-8 · PubMed

Other PDB entries of the same protein (UniProt P13020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6I4E 1.22 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-ADP state
6I4D 1.24 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-K-ATP/ADP state
4CBU 1.3 Å, Crystal structure of Plasmodium falciparum actin I
5MVV 1.4 Å, Crystal structure of Plasmodium falciparum actin I- gelsolin segment 1 -CdATP complex
6I4H 1.4 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Ca-ATP state
6I4F 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (A272W mutant) in the Mg-K-ATP/ADP…
6I4J 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-ADP state
6I4K 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Ca-ATP state
6I4L 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Mg-K-ATP/ADP…
6I4M 1.87 Å, Crystal Structure of Plasmodium berghei actin II in the Mg-ADP state
6I4I 1.9 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-K-ADP-AlFn…
6I4G 2.0 Å, Crystal Structure of Plasmodium falciparum actin I (H74Q) in the Mg-K-ATP state

Browse structure collections

About this viewer

MolViewer shows 1NPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.