1NQ2: Two RTH Mutants with Impaired Hormone Binding

Two RTH Mutants with Impaired Hormone Binding. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Apr 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,184
Mol. weight: 30.77 kDa
Ligands: ARS, 4HY
Released: 15 Apr 2003

Explore 1NQ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NQ2 contains 17 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	202-207	6
α-helix	212-215	4
α-helix	216-232	17
β-strand	244-245	2	1
α-helix	246-247	2
α-helix	266-273	8
α-helix	276-288	13
α-helix	291-294	4
α-helix	298-318	21
β-strand	322	1	2
β-strand	327	1	2
β-strand	328-330	3	1
β-strand	334-336	3	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	361-363	3
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-442	26
α-helix	448-450	3
α-helix	453-458	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta-1	A	protein	264	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NQ2_1 Thyroid hormone receptor beta-1 (chains A)
ASAAEELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVN
APEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRT
AVRYEPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVL
LMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHAS
RFLHMKVECPTELFPPLFLEVFED

Ligands and cofactors

ID	Name	Formula	Copies
ARS	Arsenic	As	5
4HY	[4-(4-hydroxy-3-iodo-phenoxy)-3,5-diiodo-phenyl]-acetic acid	C14 H9 I3 O4	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Two resistance to thyroid hormone mutants with impaired hormone binding. Huber, B.R., Sandler, B., West, B.L. et al. Mol Endocrinol (2003) 17:643-652. DOI 10.1210/me.2002-0095 · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
2J4A 2.2 Å, Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
3D57 2.2 Å, TR Variant D355R
3GWS 2.2 Å, Crystal Structure of T3-Bound Thyroid Hormone Receptor
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ0 2.4 Å, TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release…
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions
3JZC 2.5 Å, Crystal Structure of TR-beta bound to the selective thyromimetic TRIAC

Browse structure collections

About this viewer

MolViewer shows 1NQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.