3GWS: T3-Bound Thyroid Hormone Receptor

Crystal Structure of T3-Bound Thyroid Hormone Receptor. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Apr 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,132
Mol. weight: 30.26 kDa
Ligands: T3
Released: 28 Apr 2009

Explore 3GWS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GWS contains 17 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 17 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	203-208	6
α-helix	212-215	4
α-helix	216-231	16
α-helix	239-242	4
β-strand	244-245	2	1
α-helix	246-247	2
α-helix	266-274	9
α-helix	276-288	13
α-helix	291-294	4
α-helix	298-318	21
β-strand	322	1	2
β-strand	327	1	2
β-strand	328-330	3	1
β-strand	334-336	3	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	361-363	3
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-445	29
α-helix	453-459	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta	X	protein	259	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>3GWS_1 Thyroid hormone receptor beta (chains X)
EELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEG
GKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRY
DPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSS
DRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLH
MKVECPTELFPPLFLEVFE

Ligands and cofactors

ID	Name	Formula	Copies
T3	3,5,3'TRIIODOTHYRONINE	C15 H12 I3 N O4	1

Primary citation

Structural rearrangements in the thyroid hormone receptor hinge domain and their putative role in the receptor function. Nascimento, A.S., Dias, S.M.G., Nunes, F.M. et al. J Mol Biol (2006) 360:586-598. DOI 10.1016/j.jmb.2006.05.008 · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
2J4A 2.2 Å, Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
3D57 2.2 Å, TR Variant D355R
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ0 2.4 Å, TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release…
1NQ2 2.4 Å, Two RTH Mutants with Impaired Hormone Binding
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions
3JZC 2.5 Å, Crystal Structure of TR-beta bound to the selective thyromimetic TRIAC

Browse structure collections

About this viewer

MolViewer shows 3GWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.