2J4A: Thyroid hormone receptor beta-1

Name: PDB 2J4A: Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
Published: 2007-09-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Sept 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,096
Mol. weight: 29.01 kDa
Ligands: OEF
Released: 25 Sept 2007

Explore 2J4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J4A contains 14 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	212-215	4
α-helix	216-232	17
α-helix	239-242	4
β-strand	244-245	2	1
α-helix	266-287	22
α-helix	291-294	4
α-helix	298-318	21
β-strand	321-322	2	1
β-strand	327-330	4	1
β-strand	334-337	4	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-445	29
α-helix	448-450	3
α-helix	453-459	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta-1	A	protein	253	HOMO SAPIENS	P10828 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2J4A_1 THYROID HORMONE RECEPTOR BETA-1 (chains A)
GHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEA
FSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETL
TLSGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLAC
VERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPT
ELFPPLFLEVFED

Ligands and cofactors

ID	Name	Formula	Copies
OEF	3,5-dibromo-4-(3-isopropyl-phenoxy)benzoic acid	C18 H18 Br2 O4	1

Primary citation

Thyroid Receptor Ligands. 6. A High Affinity "Direct Antagonist" Selective for the Thyroid Hormone Receptor. Koehler, K., Gordon, S., Brandt, P. et al. J Med Chem (2006) 49:6635. DOI 10.1021/JM060521I · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
3D57 2.2 Å, TR Variant D355R
3GWS 2.2 Å, Crystal Structure of T3-Bound Thyroid Hormone Receptor
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ0 2.4 Å, TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release…
1NQ2 2.4 Å, Two RTH Mutants with Impaired Hormone Binding
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions
3JZC 2.5 Å, Crystal Structure of TR-beta bound to the selective thyromimetic TRIAC

Browse structure collections

About this viewer

MolViewer shows 2J4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.