3JZC: TR-beta

Crystal Structure of TR-beta bound to the selective thyromimetic TRIAC. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Dec 2009.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,999
Mol. weight: 30.72 kDa
Ligands: 4HY
Released: 8 Dec 2009

Explore 3JZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JZC contains 15 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	203-208	6
α-helix	212-215	4
α-helix	216-230	15
β-strand	244-245	2	1
α-helix	266-288	23
α-helix	291-294	4
α-helix	298-318	21
β-strand	322	1	2
β-strand	327	1	2
β-strand	328-330	3	1
β-strand	334-336	3	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	361-363	3
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-444	28
α-helix	448-450	3
α-helix	453-459	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta	A	protein	263	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JZC_1 Thyroid hormone receptor beta (chains A)
GSMEELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNA
PEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAA
VRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLL
MSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASR
FLHMKVECPTELFPPLFLEVFED

Ligands and cofactors

ID	Name	Formula	Copies
4HY	[4-(4-hydroxy-3-iodo-phenoxy)-3,5-diiodo-phenyl]-acetic acid	C14 H9 I3 O4	1

Primary citation

Gaining ligand selectivity in thyroid hormone receptors via entropy. Martinez, L., Nascimento, A.S., Nunes, F.M. et al. Proc Natl Acad Sci U S A (2009) 106:20717-20722. DOI 10.1073/pnas.0911024106 · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
2J4A 2.2 Å, Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
3D57 2.2 Å, TR Variant D355R
3GWS 2.2 Å, Crystal Structure of T3-Bound Thyroid Hormone Receptor
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ0 2.4 Å, TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release…
1NQ2 2.4 Å, Two RTH Mutants with Impaired Hormone Binding
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions

Browse structure collections

About this viewer

MolViewer shows 3JZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.