1NR2: Thymus and activation-regulated chemokine

High resolution crystal structures of thymus and activation-regulated chemokine. Determined by X-ray diffraction at 2.18 Å resolution. Released 5 Aug 2003.

Method: X-ray diffraction
Resolution: 2.18 Å
Chains: 2
Atoms: 1,229
Mol. weight: 16.19 kDa
Released: 5 Aug 2003

Explore 1NR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NR2 contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	1
α-helix	30-31	2
β-strand	39-43	5	1
β-strand	48-51	4	1
α-helix	56-66	11

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	2
β-strand	39-43	5	2
β-strand	48-51	4	2
α-helix	56-67	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thymus and activation-regulated chemokine	A, B	protein	71		Q92583 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1NR2_1 Thymus and activation-regulated chemokine (chains A, B)
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKN
AVKYLQSLERS

Primary citation

Structures of thymus and activation-regulated chemokine (TARC). Asojo, O.A., Boulegue, C., Hoover, D.M. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:1165-1173. DOI 10.1107/S0907444903009454 · PubMed

Other PDB entries of the same protein (UniProt Q92583 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S4N 1.65 Å, Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17
1NR4 1.72 Å, High resolution crystal structures of thymus and activation-regulated chemokine
5WK3 1.9 Å, Crystal structure of the complex between CCL17 and M116 FAB
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17

Browse structure collections

About this viewer

MolViewer shows 1NR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.