1O4X: Transcription factor Oct-1

Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors with a 19MER oligonucleotide from the HOXB1 regulatory element. Determined by solution NMR. Released 27 Jan 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 2,502
Mol. weight: 41.45 kDa
Released: 27 Jan 2004

Explore 1O4X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O4X contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	10-26	17
α-helix	31-42	12
α-helix	48-56	9
α-helix	61-77	17
α-helix	113-125	13
α-helix	131-141	11
α-helix	145-159	15

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	207-213	7
α-helix	214-229	16
α-helix	235-246	12
α-helix	251-271	21
α-helix	279-281	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tpgptpcptptptpgptpcpaptpgpcptpapaptp*g)-3'	C	DNA	19
5'-d(cpaptptpapgpcpaptpgpapcpapapapgpapcp*a)-3'	D	DNA	19
transcription factor Oct-1	A	protein	167	Homo sapiens	P14859 (AlphaFold model)
Transcription factor SOX-2	B	protein	88	Homo sapiens	P48431 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1O4X_1 5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*G)-3' (chains C)
TGTCTTTGTCATGCTAATG

Sequence of entity 2 (D), FASTA

>1O4X_2 5'-D(*CP*AP*TP*TP*AP*GP*CP*AP*TP*GP*AP*CP*AP*AP*AP*GP*AP*CP*A)-3' (chains D)
CATTAGCATGACAAAGACA

Sequence of entity 3 (A), FASTA

>1O4X_3 transcription factor Oct-1 (chains A)
GSHMEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLS
FKNMAKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSERRKKRTSIETNIRVALE
KSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSS

Sequence of entity 4 (B), FASTA

>1O4X_4 Transcription factor SOX-2 (chains B)
GSHMPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE
AKRLRALHMKEHPDYKYRPRRKTKTLMK

Primary citation

Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex. Williams, D.C., Cai, M., Clore, G.M. J Biol Chem (2004) 279:1449-1457. DOI 10.1074/jbc.M309790200 · PubMed

Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E3O 1.9 Å, Crystal structure of Oct-1 POU dimer bound to MORE
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
1HF0 2.7 Å, Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
1OCT 3.0 Å, Crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with…
1CQT 3.2 Å, Crystal structure of a ternary complex containing an oca-B peptide, the oct-1 pou…
1POG Solution structure of the oct-1 pou-homeo domain determined by NMR and restrained…
1POU The solution structure of the oct-1 pou-specific domain reveals a striking similarity to…

Browse structure collections

About this viewer

MolViewer shows 1O4X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.