1OAN: Dengue 2 virus envelope protein

Name: PDB 1OAN: Crystal structure of the dengue 2 virus envelope protein
Published: 2003-05-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: glycoprotein

Crystal structure of the dengue 2 virus envelope protein. Determined by X-ray diffraction at 2.75 Å resolution. Released 16 May 2003.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: DENGUE VIRUS TYPE 2
Chains: 2
Atoms: 6,296
Mol. weight: 89.57 kDa
Ligands: NAG
Released: 16 May 2003

Explore 1OAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OAN contains 14 α-helices and 82 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	20-25	6	2
β-strand	30-35	6	1
β-strand	38-44	7	1
β-strand	48-50	3	1
β-strand	54	1	3
β-strand	57-59	3	4
β-strand	60-72	13	5
α-helix	83-86	4
β-strand	90-99	10	5
α-helix	101-103	3
β-strand	109-124	16	5
β-strand	128	1	6
β-strand	129	1	3
α-helix	132-134	3
β-strand	135-143	9	1
β-strand	160-164	5	1
β-strand	171-175	5	2
β-strand	179-186	8	2
β-strand	196-197	2	7
β-strand	198	1	6
β-strand	200-202	3	8
β-strand	204-205	2	8
β-strand	207	1	9
β-strand	208-209	2	7
α-helix	210-214	5
β-strand	220-222	3	4
β-strand	232	1	4
α-helix	234-236	3
β-strand	238-241	4	10
β-strand	249-252	4	10
α-helix	257-263	7
β-strand	268	1	9
β-strand	272-273	2	11
β-strand	276-277	2	11
β-strand	283-288	6	2
β-strand	292	1	2
β-strand	301	1	12
β-strand	306-314	9	13
β-strand	320-326	7	13
β-strand	333-334	2	12
α-helix	335-336	2
β-strand	337-340	4	14
β-strand	347-349	3	14
β-strand	350-351	2	13
β-strand	357-358	2	12
β-strand	365-370	6	13
β-strand	374-380	7	14
β-strand	387-393	7	14

Chain B: 7 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	15
β-strand	20-25	6	16
β-strand	30-35	6	15
β-strand	38-44	7	15
β-strand	48-50	3	15
β-strand	54	1	17
β-strand	57-59	3	18
β-strand	60-72	13	19
α-helix	83-86	4
β-strand	90-99	10	19
α-helix	101-103	3
β-strand	109-124	16	19
β-strand	129	1	17
α-helix	132-134	3
β-strand	135-143	9	15
β-strand	160-164	5	15
β-strand	171-175	5	16
β-strand	179-186	8	16
β-strand	196-197	2	20
β-strand	200-202	3	21
β-strand	204-205	2	21
β-strand	207	1	22
β-strand	208-209	2	20
α-helix	210-214	5
β-strand	220-222	3	18
β-strand	232	1	18
α-helix	234-237	4
β-strand	238-241	4	23
β-strand	249-252	4	23
α-helix	257-263	7
β-strand	268	1	22
β-strand	272-273	2	24
β-strand	276-277	2	24
β-strand	283-288	6	16
β-strand	292	1	16
β-strand	301	1	25
β-strand	306-314	9	26
β-strand	320-326	7	26
β-strand	333-334	2	25
α-helix	335-336	2
β-strand	337-340	4	27
β-strand	347-349	3	27
β-strand	350-351	2	26
β-strand	357-358	2	25
β-strand	365-370	6	26
β-strand	374-380	7	27
β-strand	387-393	7	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein	A, B	protein	394	DENGUE VIRUS TYPE 2	P12823

Sequence of entity 1 (A, B), FASTA

>1OAN_1 ENVELOPE GLYCOPROTEIN (chains A, B)
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYC
IEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFT
CKKNMEGKIVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGT
VTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTF
KNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYS
MCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTE
KDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (NA) are not listed.

Primary citation

A Ligand-Binding Pocket in the Dengue Virus Envelope Glycoprotein. Modis, Y., Ogata, S., Clements, D. et al. Proc Natl Acad Sci U S A (2003) 100:6986. DOI 10.1073/PNAS.0832193100 · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
5HHG 2.2 Å, Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex
1L9K 2.4 Å, dengue methyltransferase
1OKE 2.4 Å, Crystal structure of the dengue 2 virus envelope protein in complex with…
4M9I 2.4 Å, A125C NS2B-NS3 protease from dengue virus at pH 5.5
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5

Browse more

1OAN is part of these collections:

Viruses

About this viewer

MolViewer shows 1OAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.