1OP8: Human Granzyme A

Crystal Structure of Human Granzyme A. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Jul 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 11,607
Mol. weight: 156.28 kDa
Released: 1 Jul 2003

Explore 1OP8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OP8 contains 46 α-helices and 131 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-34	5	3
β-strand	41-48	8	3
β-strand	51-54	4	3
β-strand	65-68	4	3
β-strand	72	1	4
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-108	5	3
β-strand	115	1	6
β-strand	118	1	6
α-helix	121-124	4
α-helix	130-131	2
β-strand	135-140	6	2
α-helix	151-152	2
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	165-168	4
β-strand	180-184	5	2
β-strand	189	1	1
α-helix	197	1
β-strand	198-201	4	2
β-strand	208-215	8	2
β-strand	226-230	5	2
α-helix	232A-243	12

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	7
β-strand	20-21	2	8
α-helix	22-23	2
β-strand	30-34	5	9
β-strand	41-48	8	9
β-strand	51-54	4	9
β-strand	65-68	4	9
β-strand	72	1	10
β-strand	81-83	3	9
β-strand	85-90	6	9
β-strand	95	1	11
β-strand	100	1	11
β-strand	104-108	5	9
α-helix	122-124	3
β-strand	135-140	6	8
β-strand	143	1	12
β-strand	151	1	12
α-helix	152	1
β-strand	154	1	10
β-strand	156-161	6	8
α-helix	162-164	3
α-helix	165-169	5
β-strand	180-184	5	8
β-strand	189	1	7
β-strand	198-201	4	8
β-strand	208-215	8	8
β-strand	226-230	5	8
α-helix	232A-244	13

Chain C: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	13
β-strand	20-21	2	14
α-helix	22-23	2
β-strand	30-34	5	15
β-strand	41-48	8	15
β-strand	51-54	4	15
β-strand	65-68	4	15
β-strand	72	1	16
β-strand	81-83	3	15
β-strand	85-90	6	15
β-strand	95	1	17
β-strand	100	1	17
β-strand	104-108	5	15
β-strand	115	1	18
β-strand	118	1	18
α-helix	121-124	4
α-helix	130-131	2
β-strand	135-140	6	14
β-strand	154	1	16
β-strand	156-163	8	14
α-helix	164	1
α-helix	167-169	3
α-helix	175-176	2
β-strand	180-184	5	14
β-strand	189	1	13
α-helix	197	1
β-strand	198-201	4	14
β-strand	208-215	8	14
α-helix	225	1
β-strand	226-230	5	14
α-helix	232A-243	12

Chain D: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	19
β-strand	20-21	2	20
α-helix	22-23	2
β-strand	30-34	5	21
β-strand	41-48	8	21
β-strand	51-54	4	21
β-strand	65-68	4	21
β-strand	72	1	22
β-strand	81-83	3	21
β-strand	85-90	6	21
β-strand	95	1	23
β-strand	100	1	23
β-strand	104-108	5	21
α-helix	122-124	3
β-strand	135-140	6	20
β-strand	154	1	22
β-strand	156-163	8	20
α-helix	164	1
α-helix	167-169	3
β-strand	180-184	5	20
β-strand	189	1	19
α-helix	197	1
β-strand	198-201	4	20
β-strand	208-215	8	20
β-strand	226-230	5	20
α-helix	232A-242	11

Chain E: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	24
β-strand	20-21	2	25
α-helix	22-23	2
β-strand	30-34	5	26
β-strand	41-48	8	26
β-strand	51-54	4	26
β-strand	65-68	4	26
β-strand	72	1	27
β-strand	81-83	3	26
β-strand	85-90	6	26
β-strand	95	1	28
β-strand	100	1	28
β-strand	104-108	5	26
α-helix	111-112	2
α-helix	120-124	5
α-helix	130-131	2
β-strand	135-140	6	25
α-helix	151-152	2
β-strand	154	1	27
β-strand	156-161	6	25
β-strand	163	1	25
α-helix	165-168	4
α-helix	175-176	2
β-strand	180-183	4	25
β-strand	189	1	24
α-helix	197	1
β-strand	198-201	4	25
β-strand	208-215	8	25
α-helix	225	1
β-strand	226-230	5	25
α-helix	232A-243	12

Chain F: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	29
β-strand	20-21	2	30
α-helix	22-23	2
β-strand	30-34	5	31
β-strand	41-48	8	31
β-strand	51-55	5	31
β-strand	65-68	4	31
β-strand	72	1	32
β-strand	81-83	3	31
β-strand	85-90	6	31
β-strand	95	1	33
β-strand	100	1	33
β-strand	103-108	6	31
β-strand	115	1	34
β-strand	118	1	34
α-helix	122-124	3
α-helix	128-131	4
β-strand	135-140	6	30
β-strand	143	1	35
β-strand	151	1	35
α-helix	152	1
β-strand	154	1	32
β-strand	156-163	8	30
α-helix	164	1
α-helix	165-169	5
β-strand	180-184	5	30
β-strand	189	1	29
α-helix	197	1
β-strand	198-201	4	30
β-strand	208-215	8	30
β-strand	226-230	5	30
α-helix	232A-243	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Granzyme A	A, B, C, D, E, F	protein	234	Homo sapiens	P12544 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1OP8_1 Granzyme A (chains A, B, C, D, E, F)
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITRE
EPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMC
QVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSC
NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Primary citation

Crystal structure of the apoptosis-inducing human granzyme A dimer. Hink-Schauer, C., Estebanez-Perpina, E., Kurschus, F. et al. Nat Struct Biol (2003) 10:535-540. DOI 10.1038/nsb945 · PubMed

Other PDB entries of the same protein (UniProt P12544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORF 2.4 Å, The Oligomeric Structure of Human Granzyme A Reveals the Molecular Determinants of…
9K1S 2.69 Å, Crystal structure of human granzyme A in complex with GSDMB-C domain
9XSG 3.4 Å, CryoEM structure of hGZMA-hGSDMB
21AM 3.59 Å, CryoEM structure of hGZMA-hGSDMBctd

Browse structure collections

About this viewer

MolViewer shows 1OP8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.