21AM: HGZMA-hGSDMBctd

CryoEM structure of hGZMA-hGSDMBctd. Determined by electron microscopy at 3.59 Å resolution. Released 9 Sept 2026.

Method: Electron microscopy
Resolution: 3.59 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,048
Mol. weight: 148.97 kDa
Released: 9 Sept 2026

Explore 21AM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

21AM contains 28 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	1
β-strand	33-34	2	2
α-helix	35-36	2
β-strand	43-47	5	3
β-strand	53-60	8	3
β-strand	63-66	4	3
β-strand	77-80	4	3
β-strand	84	1	4
β-strand	93-95	3	3
β-strand	97-102	6	3
β-strand	107	1	5
β-strand	112	1	5
β-strand	116-120	5	3
β-strand	127	1	6
β-strand	130	1	6
α-helix	132-136	5
α-helix	140-143	4
β-strand	147-152	6	2
β-strand	155	1	7
β-strand	162	1	7
β-strand	165	1	4
β-strand	167-174	8	2
α-helix	176-179	4
β-strand	195-199	5	2
β-strand	206	1	1
α-helix	214	1
β-strand	215-218	4	2
β-strand	221-228	8	2
β-strand	242-245	4	2
α-helix	248-257	10

Chain B: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	8
β-strand	33-34	2	9
α-helix	35-36	2
β-strand	43-47	5	10
β-strand	54-60	7	10
β-strand	63-66	4	10
β-strand	77-80	4	10
β-strand	84	1	11
β-strand	93-95	3	10
β-strand	97-102	6	10
β-strand	107	1	12
β-strand	112	1	12
β-strand	116-120	5	10
β-strand	127	1	13
β-strand	130	1	13
α-helix	133-136	4
α-helix	140-143	4
β-strand	147-152	6	9
β-strand	155	1	14
β-strand	162	1	14
β-strand	165	1	11
β-strand	167-174	8	9
α-helix	176-179	4
β-strand	195-199	5	9
β-strand	206	1	8
α-helix	214	1
β-strand	215-218	4	9
β-strand	221-228	8	9
β-strand	242-245	4	9
α-helix	248-257	10

Chain D: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	255-266	12
α-helix	270-281	12
α-helix	287-303	17
α-helix	313-319	7
β-strand	320	1	15
β-strand	326	1	15
α-helix	328-342	15
α-helix	347-357	11
α-helix	360-377	18
α-helix	389-409	21

Chain E: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	255-266	12
α-helix	270-281	12
α-helix	287-303	17
α-helix	313-319	7
β-strand	320	1	16
β-strand	326	1	16
α-helix	328-343	16
α-helix	347-357	11
α-helix	360-377	18
α-helix	389-409	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Granzyme A	A, B	protein	243	Homo sapiens	P12544 (AlphaFold model)
Gasdermin-B	D, E	protein	417	Homo sapiens	Q8TAX9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>21AM_1 Granzyme A (chains A, B)
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITRE
EPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMC
QVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSC
NGDAGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVGKTHHH
HHH

Sequence of entity 2 (D, E), FASTA

>21AM_2 Gasdermin-B (chains D, E)
SMFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLM
DILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIK
ISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFW
SQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGAS
SCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSE
VLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGT
LPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS

Primary citation

CryoEM structure of hGZMA-hGSDMBctd. Zhao, X., Zhang, K., Liu, Z. To be published.

Other PDB entries of the same protein (UniProt P12544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORF 2.4 Å, The Oligomeric Structure of Human Granzyme A Reveals the Molecular Determinants of…
1OP8 2.5 Å, Crystal Structure of Human Granzyme A
9K1S 2.69 Å, Crystal structure of human granzyme A in complex with GSDMB-C domain
9XSG 3.4 Å, CryoEM structure of hGZMA-hGSDMB

Browse structure collections

About this viewer

MolViewer shows 21AM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.