The Oligomeric Structure of Human Granzyme A Reveals the Molecular Determinants of Substrate Specificity. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Jul 2003.
Explore 1ORF in 3D Show helices and sheets RCSB PDB PDBe
1ORF contains 6 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-34 | 5 | 3 |
| β-strand | 40-48 | 8 | 3 |
| β-strand | 51-54 | 4 | 3 |
| β-strand | 64-68 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 81-83 | 3 | 3 |
| β-strand | 85-90 | 6 | 3 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 120-124 | 5 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 4 |
| β-strand | 156-163 | 8 | 2 |
| α-helix | 164 | 1 | |
| α-helix | 165-168 | 4 | |
| β-strand | 180-184A | 5 | 2 |
| β-strand | 189 | 1 | 1 |
| α-helix | 197 | 1 | |
| β-strand | 198-201 | 4 | 2 |
| β-strand | 208-215 | 8 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 233A-242 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Granzyme A | A | protein | 234 | Homo sapiens | P12544 (AlphaFold model) |
>1ORF_1 Granzyme A (chains A) IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITRE EPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMC QVAGWGRTHNSASWSDTLREVEITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSC NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 0G6 | D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexa… | C21 H34 Cl N6 O3 | 1 |
Water and common crystallization additives (SO4) are not listed.
The oligomeric structure of human granzyme A is a determinant of its extended substrate specificity. Bell, J.K., Goetz, D.H., Mahrus, S. et al. Nat Struct Biol (2003) 10:527-534. DOI 10.1038/nsb944 · PubMed
Other PDB entries of the same protein (UniProt P12544 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ORF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.