9K1S: Human granzyme A

Crystal structure of human granzyme A in complex with GSDMB-C domain. Determined by X-ray diffraction at 2.69 Å resolution. Released 18 Feb 2026.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,175
Mol. weight: 93.75 kDa
Released: 18 Feb 2026

Explore 9K1S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9K1S contains 28 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	1
β-strand	33-34	2	2
α-helix	35-36	2
β-strand	43-49	7	3
β-strand	52-60	9	3
β-strand	63-66	4	3
β-strand	77-80	4	3
β-strand	84	1	4
β-strand	93-95	3	3
β-strand	97-102	6	3
β-strand	107	1	5
β-strand	112	1	5
β-strand	116-120	5	3
α-helix	133-136	4
α-helix	140-143	4
β-strand	147-152	6	2
β-strand	155	1	6
β-strand	162	1	6
β-strand	165	1	4
β-strand	167-174	8	2
α-helix	175	1
α-helix	176-179	4
β-strand	195-199	5	2
β-strand	206	1	1
β-strand	215-218	4	2
β-strand	221-228	8	2
β-strand	241-245	5	2
α-helix	248-258	11

Chain C: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	254-265	12
α-helix	270-281	12
α-helix	287-303	17
α-helix	313-318	6
β-strand	320	1	13
β-strand	326	1	13
α-helix	328-343	16
α-helix	347-356	10
α-helix	360-374	15
α-helix	389-409	21

Chain D: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	254-265	12
α-helix	270-281	12
α-helix	287-303	17
α-helix	313-318	6
β-strand	320	1	14
β-strand	326	1	14
α-helix	328-343	16
α-helix	347-356	10
α-helix	360-374	15
α-helix	389-408	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Granzyme A	A, B	protein	242	Homo sapiens	P12544 (AlphaFold model)
Isoform 4 of Gasdermin-B	C, D	protein	176	Homo sapiens	Q8TAX9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9K1S_1 Granzyme A (chains A, B)
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITRE
EPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMC
QVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSC
NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVLEHHHH
HH

Sequence of entity 2 (C, D), FASTA

>9K1S_2 Isoform 4 of Gasdermin-B (chains C, D)
SGRPSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEV
LISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTL
PLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS

Primary citation

Exosite-mediated targeting of GSDMB by dimeric granzyme A in lymphocyte pyroptotic killing. Zhong, X., Su, Y., Zhou, Z. et al. Immunity (2026) 59:257. DOI 10.1016/j.immuni.2025.12.009 · PubMed

Other PDB entries of the same protein (UniProt P12544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORF 2.4 Å, The Oligomeric Structure of Human Granzyme A Reveals the Molecular Determinants of…
1OP8 2.5 Å, Crystal Structure of Human Granzyme A
9XSG 3.4 Å, CryoEM structure of hGZMA-hGSDMB
21AM 3.59 Å, CryoEM structure of hGZMA-hGSDMBctd

Browse structure collections

About this viewer

MolViewer shows 9K1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.