1P0R: UBL5 a human Ubiquitin-Like Protein

Solution Structure of UBL5 a human Ubiquitin-Like Protein. Determined by solution NMR. Released 28 Oct 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 600
Mol. weight: 10.73 kDa
Released: 28 Oct 2003

Explore 1P0R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P0R contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	12-18	7	1
α-helix	24-32	9
β-strand	43-45	3	1
β-strand	66-71	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ubiquitin-like 5	A	protein	93	Homo sapiens	Q9BZL1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1P0R_1 ubiquitin-like 5 (chains A)
MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWN
KIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Primary citation

Structural analysis of UBL5, a novel ubiquitin-like modifier. McNally, T., Huang, Q., Janis, R.S. et al. Protein Sci (2003) 12:1562-1566. DOI 10.1110/ps.0382803 · PubMed

Other PDB entries of the same protein (UniProt Q9BZL1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PYU 2.0 Å, The conserved ubiquitin-like protein hub1 plays a critical role in splicing in human cells
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
6AHD 3.8 Å, The Cryo-EM Structure of Human Pre-catalytic Spliceosome (B complex) at 3.8 angstrom…
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
7AAV 4.2 Å, Human pre-Bact-2 spliceosome core structure
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
7ABI 8.0 Å, Human pre-Bact-2 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)

Browse structure collections

About this viewer

MolViewer shows 1P0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.