1P22: F-box/WD-repeat protein 1A

Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase. Determined by X-ray diffraction at 2.95 Å resolution. Released 8 Jul 2003.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,340
Mol. weight: 69.2 kDa
Released: 8 Jul 2003

Explore 1P22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P22 contains 17 α-helices and 34 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	144-147	4
α-helix	149-151	3
α-helix	154-161	8
α-helix	166-175	10
α-helix	177-185	9
α-helix	188-197	10
α-helix	201-208	8
α-helix	212-215	4
α-helix	230-249	20
β-strand	260-261	2	1
β-strand	270-274	5	2
β-strand	279-284	6	2
β-strand	289-293	5	2
β-strand	299-303	5	2
β-strand	310-314	5	3
β-strand	319-324	6	3
β-strand	329-333	5	3
β-strand	339-343	5	3
β-strand	350-354	5	4
β-strand	359-364	6	4
β-strand	369-373	5	4
β-strand	381-386	6	4
β-strand	393-399	7	5
β-strand	402-407	6	5
β-strand	411-416	6	5
β-strand	422-427	6	5
β-strand	433-439	7	6
β-strand	442-447	6	6
β-strand	452-456	5	6
β-strand	462-466	5	6
β-strand	473-477	5	7
β-strand	482-487	6	7
β-strand	492-496	5	7
α-helix	497-500	4
β-strand	511-515	5	7
β-strand	525-527	3	8
β-strand	532-534	3	8
β-strand	540-541	2	1
β-strand	542-544	3	8

Chain B: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	9
β-strand	13-16	4	9
α-helix	25-32	8
β-strand	39-41	3	9
α-helix	46-56	11
α-helix	67-71	5
α-helix	76-86	11
α-helix	92-104	13
α-helix	111-118	8
α-helix	126-133	8

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	32	1	10
β-strand	35	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/WD-repeat protein 1A	A	protein	435	Homo sapiens	Q9Y297 (AlphaFold model)
Skp1	B	protein	145	Homo sapiens	P63208 (AlphaFold model)
Beta-catenin	C	protein	26	Homo sapiens	P35222 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1P22_1 F-box/WD-repeat protein 1A (chains A)
SPAIMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIE
RMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGR
HSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQ
YDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDM
ASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIA
CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKV
WDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQA
EPPRSPSRTYTYISR

Sequence of entity 2 (B), FASTA

>1P22_2 Skp1 (chains B)
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDPVPLPNVNAAILKKVIQWCTHHK
DDPPDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKT
FNIKNDFTEEEEAQVRKENQWCEEK

Sequence of entity 3 (C), FASTA

>1P22_3 Beta-catenin (chains C)
KAAVSHWQQQSYLDSGIHSGATTTAP

Primary citation

Structure of a beta-TrCP1-Skp1-beta-Catenin complex: destruction motif binding and lysine specificity of the SCFbeta-TrCP1 ubiquitin ligase. Wu, G., Xu, G., Schulman, B.A. et al. Mol Cell (2003) 11:1445-1456. DOI 10.1016/S1097-2765(03)00234-X · PubMed

Other PDB entries of the same protein (UniProt Q9Y297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9W 1.16 Å, Crystal structure of beta-TrCP bound by diphosphorylated I-kappa-B-alpha degron peptide
9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
9TDZ 1.35 Å, Crystal structure of beta-TrCP bound by diphosphorylated claspin degron peptide
9TG7 1.68 Å, Crystal structure of beta-TrCP bound by monophosphorylated WEE1 degron peptide
9T8Y 1.79 Å, Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.
9TFU 2.0 Å, Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
9T95 2.15 Å, Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2P64 2.5 Å, D domain of b-TrCP
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex

Browse structure collections

About this viewer

MolViewer shows 1P22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.