1P4O: Apo unactivated IGF-1R KInase domain

Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution. Determined by X-ray diffraction at 1.5 Å resolution. Released 29 Apr 2003.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,593
Mol. weight: 73.31 kDa
Released: 29 Apr 2003

Explore 1P4O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P4O contains 47 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	952	1	1
β-strand	963	1	2
α-helix	966-968	3
β-strand	969-977	9	2
β-strand	982-992	11	2
β-strand	995-1004	10	2
α-helix	1011-1023	13
α-helix	1024-1026	3
β-strand	1032	1	3
α-helix	1033-1034	2
β-strand	1035-1039	5	2
β-strand	1046-1050	5	2
β-strand	1056	1	3
α-helix	1057-1070	14
α-helix	1076-1078	3
α-helix	1079-1098	20
β-strand	1102	1	4
α-helix	1108-1110	3
β-strand	1111-1113	3	3
β-strand	1119-1121	3	3
α-helix	1122-1123	2
α-helix	1129-1134	6
β-strand	1136-1137	2	5
α-helix	1138-1140	3
β-strand	1143-1144	2	5
α-helix	1146-1148	3
α-helix	1151-1156	6
α-helix	1161-1177	17
α-helix	1180-1181	2
α-helix	1188-1196	9
α-helix	1201-1204	4
α-helix	1209-1218	10
α-helix	1223-1225	3
α-helix	1227-1228	2
α-helix	1229-1236	8
α-helix	1237-1239	3
α-helix	1244-1247	4

Chain B: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	952	1	4
β-strand	963	1	6
α-helix	966-968	3
β-strand	969-977	9	6
β-strand	982-992	11	6
β-strand	995-1004	10	6
α-helix	1011-1023	13
α-helix	1024-1026	3
β-strand	1032	1	7
α-helix	1033-1034	2
β-strand	1035-1039	5	6
β-strand	1046-1050	5	6
β-strand	1056	1	7
α-helix	1057-1070	14
α-helix	1076-1078	3
α-helix	1079-1098	20
β-strand	1102	1	1
α-helix	1108-1110	3
β-strand	1111-1113	3	7
β-strand	1119-1121	3	7
α-helix	1122-1123	2
α-helix	1129-1134	6
β-strand	1136-1137	2	8
α-helix	1138-1140	3
β-strand	1143-1144	2	8
α-helix	1146-1148	3
α-helix	1151-1156	6
α-helix	1161-1177	17
α-helix	1180-1181	2
α-helix	1188-1196	9
α-helix	1201-1204	4
α-helix	1209-1218	10
α-helix	1223-1225	3
α-helix	1227-1228	2
α-helix	1229-1236	8
α-helix	1237-1239	3
α-helix	1244-1247	4
α-helix	1253-1255	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor I receptor protein	A, B	protein	322	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1P4O_1 Insulin-like growth factor I receptor protein (chains A, B)
MASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAI
KTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLR
SLRPAMANNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP
YQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEP
GFREVSFYYSEENKLPEPEELD

Primary citation

Structure of apo, unactivated insulin-like growth factor-1 receptor kinase at 1.5 A resolution. Munshi, S., Hall, D.L., Kornienko, M. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:1725-1730. DOI 10.1107/S0907444903015415 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 1P4O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.