1P5Q: FKBP52 C-terminal Domain

Crystal Structure of FKBP52 C-terminal Domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 22 Jun 2004.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,448
Mol. weight: 116.17 kDa
Released: 22 Jun 2004

Explore 1P5Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P5Q contains 35 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	150-156	7	1
β-strand	169-178	10	1
β-strand	181-191	11	1
α-helix	195-198	4
α-helix	202-208	7
β-strand	216-221	6	1
β-strand	232	1	2
α-helix	233-235	3
β-strand	237	1	2
α-helix	238	1
β-strand	243-253	11	1
α-helix	254-257	4
α-helix	258-260	3
α-helix	263-283	21
α-helix	286-299	14
α-helix	309-331	23
α-helix	335-348	14
α-helix	353-365	13
α-helix	369-382	14
α-helix	387-424	38

Chain B: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	150-156	7	3
β-strand	169-178	10	3
β-strand	181-191	11	3
α-helix	195-198	4
α-helix	202-208	7
α-helix	211-212	2
β-strand	216-221	6	3
α-helix	223-225	3
β-strand	232	1	4
β-strand	237	1	4
β-strand	243-253	11	3
α-helix	263-282	20
α-helix	286-300	15
α-helix	309-331	23
α-helix	335-346	12
α-helix	353-365	13
α-helix	369-382	14
α-helix	387-424	38

Chain C: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	150-156	7	5
β-strand	169-178	10	5
β-strand	181-191	11	5
α-helix	195-198	4
α-helix	202-208	7
β-strand	215-221	7	5
α-helix	223-225	3
β-strand	232	1	6
α-helix	233-235	3
β-strand	237	1	6
β-strand	243-245	3	5
β-strand	248-251	4	5
α-helix	263-282	20
α-helix	286-299	14
α-helix	309-331	23
α-helix	335-346	12
α-helix	353-365	13
α-helix	369-380	12
α-helix	387-424	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FK506-binding protein 4	A, B, C	protein	336	Homo sapiens	Q02790 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1P5Q_1 FK506-binding protein 4 (chains A, B, C)
MGSSHHHHHHSSGLVPRGSHMEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLF
DQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAEL
KYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYE
SSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAH
LAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEEN
KAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Primary citation

3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex. Wu, B., Li, P., Liu, Y. et al. Proc Natl Acad Sci U S A (2004) 101:8348-8353. DOI 10.1073/pnas.0305969101 · PubMed

Other PDB entries of the same protein (UniProt Q02790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LAY 1.7 Å, Crystal Structure Analysis of FKBP52, Complex with I63
4DRJ 1.8 Å, o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
4LAV 1.8 Å, Crystal Structure Analysis of FKBP52, Crystal Form II
1Q1C 1.9 Å, Crystal structure of N(1-260) of human FKBP52
4LAX 2.01 Å, Crystal Structure Analysis of FKBP52, Complex with FK506
6RCY 2.3 Å, Crystal structure of FK1 domain of FKBP52 in complex with a bio-inspired hybrid…
1N1A 2.4 Å, Crystal Structure of the N-terminal domain of human FKBP52
4LAW 2.4 Å, Crystal Structure Analysis of FKBP52, Crystal Form III
1QZ2 3.0 Å, Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD…
4TW8 3.0 Å, The Fk1-Fk2 domains of FKBP52 in complex with iFit-FL
8FFV 3.01 Å, Cryo-EM structure of the GR-Hsp90-FKBP52 complex

Browse structure collections

About this viewer

MolViewer shows 1P5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.