1P8X: Gelsolin precursor, plasma

The Calcium-Activated C-terminal half of gelsolin. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Oct 2003.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,544
Mol. weight: 113.65 kDa
Ligands: CA
Released: 14 Oct 2003

Explore 1P8X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P8X contains 41 α-helices and 56 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	420-426	7	1
β-strand	429-432	4	1
α-helix	433-434	2
α-helix	435-437	3
β-strand	440-442	3	2
β-strand	446-455	10	1
β-strand	458-467	10	1
α-helix	473-489	17
β-strand	495-500	6	1
α-helix	506-510	5
α-helix	515-516	2
β-strand	517-520	4	2
α-helix	530-534	5
β-strand	537-543	7	2
β-strand	549-554	6	2
α-helix	558-560	3
β-strand	562	1	3
β-strand	566-570	5	2
β-strand	575-579	5	2
α-helix	585-597	13
α-helix	601-602	2
β-strand	603-606	4	2
α-helix	612-617	6
β-strand	625	1	3
α-helix	628-631	4
β-strand	641-644	4	4
α-helix	663-665	3
β-strand	671-675	5	4
β-strand	680-684	5	4
α-helix	690-706	17
β-strand	717-721	5	4
α-helix	727-730	4

Chain B: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	420-426	7	5
β-strand	429-432	4	5
α-helix	435-437	3
β-strand	440-442	3	6
β-strand	446-452	7	5
β-strand	461-467	7	5
α-helix	473-489	17
β-strand	495-500	6	5
α-helix	506-510	5
α-helix	515-516	2
β-strand	517-520	4	6
α-helix	530-534	5
β-strand	537-543	7	6
β-strand	549-554	6	6
α-helix	558-560	3
β-strand	562	1	7
β-strand	566-570	5	6
β-strand	575-579	5	6
α-helix	585-597	13
α-helix	601-602	2
β-strand	603-606	4	6
α-helix	612-617	6
β-strand	625	1	7
α-helix	628-631	4
β-strand	641-646	6	8
β-strand	653-656	4	8
α-helix	663-665	3
β-strand	671-675	5	8
β-strand	680-684	5	8
α-helix	690-705	16
α-helix	708-710	3
β-strand	717-721	5	8
α-helix	727-730	4

Chain C: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	420-426	7	9
β-strand	429-432	4	9
α-helix	435-437	3
β-strand	440-442	3	10
β-strand	446-452	7	9
β-strand	461-467	7	9
α-helix	473-489	17
β-strand	495-500	6	9
α-helix	506-510	5
α-helix	515-516	2
β-strand	517-520	4	10
α-helix	531-534	4
β-strand	537-543	7	10
β-strand	549-554	6	10
α-helix	558-560	3
β-strand	562	1	11
β-strand	566-570	5	10
β-strand	575-579	5	10
α-helix	585-597	13
β-strand	603-606	4	10
α-helix	612-617	6
β-strand	625	1	11
α-helix	628-631	4
β-strand	641-646	6	12
β-strand	653-657	5	12
α-helix	663-665	3
β-strand	671-675	5	12
β-strand	680-684	5	12
α-helix	690-705	16
α-helix	708-710	3
β-strand	717-721	5	12
α-helix	727-730	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gelsolin precursor, plasma	A, B, C	protein	344	Homo sapiens	P06396 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1P8X_1 Gelsolin precursor, plasma (chains A, B, C)
MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQS
TQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQT
APASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGA
QELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGR
FVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANR
DRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	9

Primary citation

Activation in isolation: Exposure of the actin-binding site in the C-terminal half of gelsolin does not require actin. Narayan, K., Chumnarnsilpa, S., Choe, H. et al. FEBS Lett (2003) 552:82-85. DOI 10.1016/S0014-5793(03)00933-5 · PubMed

Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FAF 1.05 Å, N184K pathological variant of gelsolin domain 2 (orthorhombic form)
6QW3 1.3 Å, Calcium-bound gelsolin domain 2
6LJE 1.4 Å, Crystal structure of gelsolin G3 domain (calcium and magnesium condition)
6LJF 1.5 Å, Crystal structure of gelsolin G3 domain (calcium condition)
2FH1 1.55 Å, C-terminal half of gelsolin soaked in low calcium at pH 4.5
3CIP 1.6 Å, Complex of Dictyostelium Discoideum Actin with Gelsolin
1KCQ 1.65 Å, Human Gelsolin Domain 2 with a Cd2+ bound
3CI5 1.7 Å, Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin
5FAE 1.7 Å, N184K pathological variant of gelsolin domain 2 (trigonal form)
5O2Z 1.7 Å, Domain swap dimer of the G167R variant of gelsolin second domain
1D4X 1.75 Å, Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin…
1NLV 1.8 Å, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human…

Browse structure collections

About this viewer

MolViewer shows 1P8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.